The URL can be used to link to this page

Home My WebLink About02.12.18 CITY COUNCIL REGULAR MEETING CITY OF EVANSTON, ILLINOIS LORRAINE H. MORTON CIVIC CENTER JAMES C. LYTLE COUNCIL CHAMBERS Monday, February 12, 2018 Administration & Public Works (A&PW) Committee meets at 6 p.m. Planning & Development Committee (P&D) meets at 7:15 p.m. City Council meeting will convene at conclusion of the P&D Committee meeting. ORDER OF BUSINESS (I) Roll Call – Begin with Alderman Wilson (II) Mayor Public Announcements (III) City Manager Public Announcements (IV) Communications: City Clerk (V) Public Comment Members of the public are welcome to speak at City Council meetings. As part of the Council agenda, a period for public comments shall be offered at the commencement of each regular Council meeting. Public comments will be noted in the City Council Minutes and become part of the official record. Those wishing to speak should sign their name and the agenda item or non- agenda topic to be addressed on a designated participation sheet. If there are five or fewer speakers, fifteen minutes shall be provided for Public Comment. If there are more than five speakers, a period of forty-five minutes shall be provided for all comment, and no individual shall speak longer than three minutes. The Mayor will allocate time among the speakers to ensure that Public Comment does not exceed forty-five minutes. The business of the City Council shall commence forty-five minutes after the beginning of Public Comment. Aldermen do not respond during Public Comment. Public Comment is intended to foster dialogue in a respectful and civil manner. Public comments are requested to be made with these guidelines in mind. 1 of 549 City Council Agenda February 12, 2018 Page 2 of 12 (VI) Special Orders of Business SPECIAL ORDERS OF BUSINESS (SP1) Water Fund Update Staff will present and provide an update on the status of Wholesale Water Customers, projects being funded by the Water Fund and the drinking water lead reduction initiative. For Action (VII) Consent Agenda and Report of Standing Committees: Administration & Public Works - Alderman Rainey Planning & Development - Alderman Wynne Human Services - Alderman Braithwaite Economic Development - Alderman Rainey Rules - Alderman Rainey CONSENT AGENDA (M1) Approval of Minutes of the Regular City Council Meeting of January 22, 2018 and January 29, 2018. For Action ADMINISTRATION & PUBLIC WORKS COMMITTEE (A1) Payroll – January 8, 2018 through January 21, 2018 $ 3,193,912.48 (A2.1) FY 2017 Bills List – February 13, 2018 $ 3,359,819.15 FY 2018 Bills List – February 13, 2018 $ 2,973,670.58 Credit Card Activity (not including Amazon purchases), Period ending December 31, 2017 - Bank of America $ 159,115.23 BMO (Beta testing with New Purchasing cards) $ 2,394.26 For Action (A2.2) Amazon Credit Card Activity Period Ending December 31, 2017 $ 10,571.30 For Action 2 of 549 City Council Agenda February 12, 2018 Page 3 of 12 (A3.1) Fuel Purchases for Six Months from Gas Depot Oil Company Staff recommends City Council approval of fuel purchases for the first six (6) months of Fiscal Year 2018 in the amount of $450,000.00 from Gas Depot Oil Company (8930 N. Waukegan Road, Suite 230, Morton Grove, IL 60053). The Gas Depot Oil Company is the current Northwest Municipal Conference Bid winner through July 5, 2018 for all grades and types of fuels that are utilized by city vehicles. Funding for this purchase will be from the Major Maintenance, Materials to Maintain Autos Fund (Account 600.19.7710.65035), with a FY18 budget of $1,100,000. Present fuel prices are $2.11/gallon for 87 octane gasoline and $2.40/gallon for bio-diesel. For Action (A3.2) 2018 New Tire Purchases from Wentworth Tire Service Staff recommends City Council approval of tire purchases for the twelve (12) months in Fiscal Year 2018 in the amount of $75,000.00 from Wentworth Tire Service (300 North York Road, Bensenville, IL). Wentworth Tire Service is an authorized distributor of tires within the Illinois State Contract # 7129. Funding is provided from Fleet Services/Tires and Tubes (Account 600.26.7710.65065), with a FY18 budget of $100,000. $75,000.00 is requested for the purchasing of new tires, and the remaining $25,000.00 of the tire budget is for tire repair services (tire mounting, tire dis-mounting, road repairs, and service calls for the same time period) as a separate contract. For Action (A3.3) One-Year Renewal for Tire Repair Services with Wentworth Tire Service Staff recommends City Council approval for the City Manager to authorize a one (1) year renewal for tire repair and recap services in the amount of $24,672 with Wentworth Tire Service (300 North York Road, Bensenville, IL). This will be the second (2nd) and final renewal on this contract from January 1, 2018 through December 31, 2018. Funding is provided from Fleet Services/Tires and Tubes (Account 600.26.7710.65065), with a FY18 budget of $100,000. For Action (A3.4) One-Year Contract Renewal for Testing, Repair & Certification of Fire Apparatus and Aerial Devices Staff recommends City Council approval of a one year contract extension (RFP 15-30) to Global Emergency Products (1401 N. Farnsworth Avenue, Aurora, IL 60505) in the amount of $72,300.00, to provide the required annual inspections and repairs for heavy fire apparatus vehicles assigned to Evanston Fire Department. This will be the third and final renewal. There is no cost increase from the last renewal. Funding will be from Account 600.19.7710.65060 with a FY18 Budget of $1,050,000. For Action 3 of 549 City Council Agenda February 12, 2018 Page 4 of 12 (A3.5) Contract with Structures Construction LLC for Construction Services for the Howard Street Theatre Staff recommends that City Council authorize the City Manager to execute a contract to provide construction services for the Howard Street Theatre with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, IL 60647) in the amount of $1,385,469.00. Funding for this project will be provided from Capital Improvement Program (CIP) Howard-Ridge TIF funds (Account 415.40.4218.65515 – 617016), which has an FY 2018 budget allocation of $1,756,058.00. The Howard Ridge TIF will issue debt and will pay the debt service costs for the architectural and construction costs for this project. For Action (A3.6) Contract with Carollo Engineers, Inc. for West Plant Filter Study Staff recommends City Council authorize the City Manager to execute a contract for the West Filter Plant Study (RFP 17-58) with Carollo Engineers, Inc. (8600 W. Bryn Mawr Avenue, Suite 900N, Chicago, IL 60631) in the amount of $126,033.00. Funding for the study will be provided from the Water Fund (Account 510.40.4200.62180). This project was budgeted at $150,000.00 in FY 2018. For Action (A3.7) One-Year Renewal Agreement with Harris Computer Systems for NorthStar Utility Billing Software Staff recommends that City Council authorize the City Manager to execute a renewal of the annual sole source maintenance and support agreement for the term March 1, 2018 through February 28, 2019 with Harris Computer Systems (1 Antares Drive, Suite 400, Ottawa, Ontario) for Harris NorthStar Utility Billing software, in the amount of $41,289.90. Funding for this purchase will be from Account 510.40.4225.62340 which has an allocation of $45,000.00. This account has a YTD balance of $183,200.00. For Action (A3.8) Contract with ADS Environmental Services for 2018 Sewer Flow Monitoring Staff recommends that City Council authorize the City Manager to execute a contract for the 2018 Sewer Flow Monitoring (Bid No. 18-03) with ADS Environmental Services (340 The Bridge Street, Suite 204, Huntsville, AL 35806) in the amount of $38,000.00. Funding for this project is from the Sewer Fund, Account 515.40.4531.62180, which has an FY 2018 budget of $75,000.00. For Action 4 of 549 City Council Agenda February 12, 2018 Page 5 of 12 (A3.9) Five-Year Contract with Great Lakes Recycling, Inc. d/b/a Simple Recycling for Collection of Soft Recyclables Staff recommends that City Council authorize the City Manager to execute a five- year contract for residential soft recycling services with Great Lakes Recycling, Inc. d/b/a Simple Recycling (5425 Naiman Parkway, Solon, OH). The proposal would allow residents of single family homes or buildings of 5 units or less the ability to recycle a multitude of materials on a weekly basis. The services will not require any City funding, as the company will furnish all containers and vehicles needed for curbside pickups. For Action (A3.10)Approval of the Estimated Annual User Charge for 2018 with the MWRDGC for Disposal of Sludge Generated as Part of the Water Treatment Process Staff recommends City Council approval of the Estimated Annual User Charge for 2018 with the Metropolitan Water Reclamation District of Greater Chicago (MWRDGC) for Disposal of Sludge generated as part of the water treatment process in the amount $180,086.68. Four payments of $45,021.67 will be made beginning in February 2018 and ending November 2018. Funding for this work will be from the Water Fund, Account 510.40.4220.62420. This account has a budget of $300,000.00 allocated for MWRDGC sludge disposal fees. The YTD account balance equals $300,000.00. For Action (A3.11)Contract with Oxcart Permits System, LLC for Online Application and Processing of Oversize and Overweight Truck Permits Staff recommends the City Council authorize the City Manager to execute an on- line application and processing contract for oversize and overweight truck permits with Oxcart Permits System, LLC., (440 W Colfax, Suite 2384, Palatine, IL 60078) pending approval of Ordinance 9-O-18 – Permits for Excessive Weight and Size. Under the agreement, Oxcart will process the applicants permit, issue such permits after staff review and approval of the application, collect the permit fees and service charges from the applicant, and reimburse the City the fees collected on a monthly basis. For Action 5 of 549 City Council Agenda February 12, 2018 Page 6 of 12 (A3.12)Revision of Street Sweeping Schedule Public Works Agency staff recommends revising the street cleaning schedule in 2018 to eliminate the special cleaning areas in Zone 4, changing the days that streets in Zone 4 are cleaned to the fourth Tuesday/Wednesday of the month, and reduce the number of residential streets that are cleaned overnight (4AM to 7AM). Staff also recommends revising the street cleaning schedule to a Tuesday/Wednesday schedule for Zone 3 in 2019, Zone 2 in 2020 and Zone 1 in 2021. The estimated cost of $3,000 to purchase stickers to reflect the proposed changes on the existing signs would be funded from Account 100.40.4105.65515/Public Works Agency-Other Improvements with a FY18 Budget of $3,000. For Action (A3.13)Change Order Number 3 to Contract with Thieneman Construction, Inc. for the Water Treatment Plant Reliability Improvements Construction Staff recommends that City Council authorize the City Manager to execute Change Order No. 3 for the Water Treatment Plant Reliability Improvements Project with Thieneman Construction, Inc. (17219 Foundation Parkway, Westfield, IN 46074) for a deduction of $4,531.44 to the current contract amount to account for various minor changes to the work throughout the construction. This change order will decrease the total contract amount from the current contract price of $1,289,721.00 to $1,285,189.56, and extends the date of final completion date from October 29, 2017 to November 17, 2017. For Action (A3.14)Change Order Number 5 to the Contract with Structures Construction LLC for Dempster Beach Office Renovations Staff recommends City Council authorize the City Manager to execute Change Order 5 to the Dempster Beach Office Renovations contract (Bid No. 17-40) with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, IL) in the amount of $4,830. This will increase the overall contract amount from $276,319 to $281,149. There is no time extension associated with this change order. Funding will be provided from the Capital Improvement Program 2017 General Obligation Bonds, which has a budget of $300,000 for this project (Account No. 415.40.4117.65515 – 617015). For Action 6 of 549 City Council Agenda February 12, 2018 Page 7 of 12 (A3.15)Change Order Number 2 to the Contract with SmithGroup JJR for the Church Street South Pier Reconstruction Staff recommends that City Council authorize the City Manager to execute Change Order No. 2 with SmithGroup JJR (35 E. Wacker, Suite 2200, IL 60601), for Engineering Services for the Church Street South Pier Reconstruction Project (RFP 16-13) in the amount of $8,000. This change order increases the contract amount from $90,500.00 to $98,500.00 and extends the contract deadline by 455 days, from December 31, 2017 to March 31, 2019. Funding will be provided from the Capital Improvement Program 2018 General Obligation Bonds (Account 415.40.4118.62145 – 418017). This project was budgeted at $625,000 in FY18. For Action (A4) Resolution 9-R-18, Authorizing the Execution and Approval of A Memorandum of Understanding between the City and the Morton Grove/Niles Water Commission Staff recommends City Council adoption of Resolution 9-R-18, authorizing the approval and execution of the attached Memorandum of Understanding between the City of Evanston and the Morton Grove-Niles Water Commission for the construction and operation of an intermediate booster pump station located at 2525 Church Street. For Action (A5) Resolution 2-R-18, Approving Release of Certain Closed Session Minutes Staff recommends City Council approval of Resolution 2-R-18, releasing certain closed session meeting minutes and finding that a need still exists for confidentiality as to the remaining minutes. The City is furthering its efforts to provide access to information and openness in government through the appropriate release of closed session minutes of the City Council. For Action (A6) Resolution 6-R-18, Authorizing the Appointment of an Interim Chief Financial Officer and Interim Treasurer for the City of Evanston Staff recommends City Council adopt Resolution 6-R-18, appointing Ashley King as Interim Chief Financial Officer and Interim Treasurer. For Action (A7) Ordinance 19-O-18, Updating Authorized Signatories and Financial Institutions for Deposits/Investments of City Funds Staff recommends City Council adopt Ordinance 19-O-18, adding Ashley King, Budget Manager and Interim Chief Financial Officer/Treasurer, and Andrew Villamin, Accounting Manager, as a depository signature. For Introduction 7 of 549 City Council Agenda February 12, 2018 Page 8 of 12 (A8) Ordinance 20-O-18, Amending City Code to Allow for One-Way Traffic Flow During Willard School Drop-Off and Pick-Up Hours on Hurd Street and Central Park Avenue Staff recommends City Council adoption of Ordinance 20-O-18, amending City Code Section 10-11-4, Schedule IV (A) to establish one-way south traffic on Hurd Street between Isabella Street and Park Place, and one-way north traffic on Central Park Avenue between Park Place and Isabella Street adjacent to Willard Elementary School during drop-off and pick-up hours. Funding for signage will be through the General Fund-Traffic Control Supplies (Account 100.40.4520.65115), with a FY 2018 budget of $58,000. For Introduction (A9) Ordinance 9-O-18, Amending City Code Section 10-1-9-4, “Permits for Excessive Weight and Size” Staff recommends that City Council adopt Ordinance 9-O-18, amending Section 10-1-9-4, of the City Code to establish permits and applicable fees for excessive vehicle weight and size in accordance with limitations set forth in 625-ILCS 5/15 - 100 of the Illinois Vehicle Code. Staff recommends suspension of rules for Introduction and Action of this Ordinance at the February 12, 2018 City Council meeting. For Introduction and Action (A10) Ordinance 10-O-18, Amending City Code to Include Civil Restitution City staff recommends City Council adoption of Ordinance 10-O-18 to amend City Code Subsection 1-4-1, “General Penalties,” to include civil restitution by order of Court. This ordinance adds civil restitution to the penalties available for City Code violations, and allows a Court to order restitution beyond the maximum fine amount. Civil restitution may only be ordered by a Court after a finding of guilt or a guilty plea by a defendant. For Introduction (A11) Ordinance 23-O-18, Amending City Code Section 3-4-6(D) to Decrease the Number of Class D Liquor Licenses for Yahala Inn Staff recommends City Council adoption of Ordinance 23-O-18, amending City Code Subsection 3-4-6-(D) to decrease the number of authorized Class D liquor licenses from fifty-one (51) to fifty (50) for 811 Church LLC dba Yahala Inn, as the business is closed. Staff recommends suspension of the rules for Introduction and Action at the February 12, 2018 City Council meeting. For Introduction and Action 8 of 549 City Council Agenda February 12, 2018 Page 9 of 12 (A12) Ordinance 24-O-18, Amending City Code Section 3-4-6(D) to Increase the Nubmer of Class D Liquor Licenses for Good to Go Local Liquor Commissioner recommends City Council adoption of Ordinance 24- O-18, amending City Code Subsection 3-4-6-(D) to increase the number of Class D Liquor Licenses from fifty (50) to fifty-one (51) and permit issuance of a Class D license to Good to Go Jamaican Cuisine, LLC dba Good to Go located at 711 Howard Street. For Introduction (A13) Ordinance 26-O-18, Amending City Code Section 3-4-6(F) to Increase the Number of Class F Liquor Licenses for the Target Store located at 1616 Sherman Avenue Local Liquor Commissioner provides a recommendation to City Council regarding the adoption of Ordinance 26-O-18, amending City Code Subsection 3-4-6-(F) to increase the number of authorized Class F liquor licenses from nine (9) to ten (10), and permit issuance of a Class F license to Target Corporation dba Target Store T3283 located at 1616 Sherman Avenue. For Introduction (A14) Ordinance 28-O-18, Amending City Code Section 10-11-1 Reducing the Speed Limit on Ridge Avenue between Howard Street and Emerson Street from 30 MPH to 25 MPH Staff recommends that City Council adopt Ordinance 28-O-18 to reduce the speed limit on Ridge Avenue between Emerson Street and Howard Street to 25 mph. Staff also recommends the City Council authorize the City Manager to: 1) direct the Evanston Police Department to provide targeted enforcement of traffic regulations within the Ridge Avenue Corridor, and 2) implement split phasing of the traffic signals at the Ridge/Lake intersection on a trial basis. Funding for the estimated $10,000 to implement the split phasing of the traffic signals at the Ridge / Lake Intersection will be from Account 100.40.4520.65115, which has an FY 2108 budget allocation of $58,000. Staff further recommends suspension of rules for Introduction and Action at the February 12, 2018 City Council meeting. For Introduction and Action PLANNING & DEVELOPMENT COMMITTEE (P1) Resolution 10-R-18, Granting Municipal Use Exemption for Public Utility (Water Pump Station) at 2525 Church Street Staff and the Design and Project Review Committee (DAPR) recommend approval of Resolution 10-R-18 granting a Municipal Use Exception for the location of a Public Utility at 2525 Church Street in the OS Open Space District, where Public Utilities are neither a permitted or special use. For Action 9 of 549 City Council Agenda February 12, 2018 Page 10 of 12 (P2) Ordinance 21-O-18, Special Use Permit for a Special Educational Institution – Public in the I2 General Industrial Zoning District The Zoning Board of Appeals and City staff recommend adoption of Ordinance 21-O-18 granting special use approval for a Special Educational Institution- Public in the I2 General Industrial Zoning District in order to operate a high- school for students with behavioral and emotional needs. The applicant has complied with all zoning requirements and meets all of the standards for a special use for this district. For Introduction (P3) Ordinance 14-O-18, Granting a Special Use for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street The Zoning Board of Appeals and City staff recommend adoption of Ordinance 14-O-18 granting special use approval for a Type 2 Restaurant, Rubies, at 1723 Simpson Street in the B1 Business District. This recommendation is conditional on the replacement of the building’s glass block windows with unobstructed transparent glass and removal of iron bars on windows and doors. The applicant has complied with all zoning requirements and meets all of the standards for a special use in this district. This Ordinance was held at committee for Introduction on January 22, 2018 until February 12, 2018. For Introduction (P4) Ordinance 13-O-18, Granting a Special Use and Major Variations for the Expansion of a Religious Institution at 2014 Orrington Avenue in the R1 Single Family Residential District The Zoning Board of Appeals and City staff recommend adoption of Ordinance 13-O-18 granting special use approval for the expansion of a Religious Institution, Lubavitch Chabad of Evanston, Inc., and major zoning relief for a third story addition, in the R1 Single Family Residential District. The applicant has complied with all zoning requirements and meets all of the standards for special use and major variations for this district. For Action ECONOMIC DEVELOPMENT COMMITTEE (O1) Storefront Modernization Program Amendments Staff recommends restructuring the Storefront Modernization Program guidelines for Fiscal Year 2018 to provide a targeted and equitable eligibility tier that would provide 100% funding up front for façade renovations within the city’s Neighborhood Stabilization Program geography. Up to $100,000 in funding is to be provided by the Business District Improvement Fund (Account 100.15.5300.65522) for the Storefront Modernization Program for 2018. For Action 10 of 549 City Council Agenda February 12, 2018 Page 11 of 12 (O2) Storefront Modernization Program Application for Linmay Studio at 525 Kedzie Street Staff and Economic Development Committee recommend approval of financial assistance on a 50/50 cost-sharing basis through the Storefront Modernization Program to Linmay Studio at 525 Kedzie Street in an amount not to exceed $696.66 for improved signage. Funding will be from the Economic Development Business District Improvement Fund (Account 100.21.5300.65522). The approved Fiscal Year 2018 Budget allocated a total of $250,000 for this account to fund both the Storefront Modernization and Great Merchant Grant programs. To date, $0 has been spent from this account, leaving $250,000 available for expenditure. For Action (O3) Entrepreneurship Support Program Application – Lashing Out! Staff and Economic Development Committee recommend approval of financial assistance through the Entrepreneurship Support Program for up to $1,000 in assistance with City permitting and licensing and up to $2,500 for equipment, work space, and certifications for Lashing Out. Funding will be from the Economic Development Business Retention/Expansion Fund (Account 100.21.5300.62662). The approved Fiscal Year 2018 Budget allocated a total of $150,000 for this account. To date, $1,800 has been spent or encumbered from the account, leaving $148,200 available for expenditure. For Action APPOINTMENTS (APP1)For Appointment: Mental Health Board Jackie Haimes Mental Health Board George Hall For Action (VIII) Call of the Wards (Aldermen shall be called upon by the Mayor to announce or provide information about any Ward or City matter which an Alderman desires to bring before the Council.) {Council Rule 2.1(10)} (IX) Executive Session (X) Adjournment 11 of 549 City Council Agenda February 12, 2018 Page 12 of 12 MEETINGS SCHEDULED THROUGH FEBRUARY 2018 Upcoming Aldermanic Committee Meetings 2/19/2018 7:00 PM City Council 2/20/2018 7:00 PM Housing & Community Development Act Committee 2/21/2018 6:30 PM M/W/EBE Committee 2/26/2018 6:00 PM Administration & Public Works, Planning & Development, City Council 2/28/2018 7:00 PM Economic Development Committee Information is available about Evanston City Council meetings at: www.cityofevanston.org/citycouncil. Questions can be directed to the City Manager’s Office at 847-866-2936. The City is committed to ensuring accessibility for all citizens. If an accommodation is needed to participate in this meeting, please contact the City Manager’s Office 48 hours in advance so that arrangements can be made for the accommodation if possible. 12 of 549 For City Council meeting of February 12, 2018 Item SP1 Water Fund Status Update For Discussion To: Honorable Mayor and Members of the City Council From: David Stoneback, Public Works Agency Director Paul Moyano, Senior Project Manager Subject: Water Fund Status Update Date: February 5, 2018 Recommended Action: Staff will present and provide an update on the status of Wholesale Water Customers, projects being funded by the Water Fund and the drinking water lead reduction initiative. Memorandum 13 of 549 CITY COUNCIL REGULAR MEETING CITY OF EVANSTON, ILLINOIS LORRAINE H. MORTON CIVIC CENTER JAMES C. LYTLE COUNCIL CHAMBERS Monday, January 22nd, 2018 Present: Alderman Fiske Alderman Revelle Alderman Braithwaite Alderman Rainey Alderman Wynne Alderman Fleming Alderman Wilson Alderman Suffredin Alderman Rue Simmons (9) Absent: Presiding: Mayor Stephen Hagerty Devon Reid City Clerk 14 of 549 Mayor’s Public Announcements Mayor Hagerty congratulated Y.O.U. and City staff at Fleetwood-Jourdain and the kids at King Lab for putting up celebration in honor of Martin Luther King Day. Also thanked Faith Temple and their community for putting on a celebrating on Friday the 19th for our Police and Firefighters in the community for their hard work. Additionally, he thanked Adam Howard and Mario Miller for their work involving the Officer and Gentlemen Academy. Watch City Manager’s Public Announcements City Manager Wally Bobkiewicz introduced new City staff member Moran Hernandez. Also congratulated Erika Storlie as the new Assistant City Manager. Watch City Clerk’s Communications City Clerk had no Announcements Watch Public Comment Marlon Millner Expressed his concerns of not being able to obtain information regarding the funding and land development approval for Roycemore school. Watch Jackie Prince Informed City Council about certain parking meters in the city not working properly and certain vehicles occupying those spaces. Watch James Angelman Asked City Council to reject 1723 Rubies restaurant because the owner fail to speak about making the place a safe zone for children and having social workers in the restaurants Watch 15 of 549 Consent Agenda (M1) Approval of Minutes of the Regular City Council Meeting of January 8, 2018. For Action Approved on Consent Agenda. Motion: Ald. Rainey Watch (A1) Payroll – December 25, 2017 through January 07, 2018 $ 2,948,470.31 (A2) Bills List – January 23, 2018 FY: 2017 $ 2,084,030.72 FY: 2018 $ 616,587.34 For Action Approved on Consent Agenda. (A3.1) Contract for Asbestos Abatement at 721-723 Howard Street with Cove Remediation, LLC City Council authorized the City Manager to execute a contract for the Asbestos Abatement at 721-723 Howard Street (Bid 18-05) with Cove Remediation, LLC (5316 W. 12th Street, Alsip, IL), in the amount of $38,000. Funding will be provided from the Howard Ridge TIF (Account 415.40.4218.65515-617016), which has $1,730,000 budgeted for the Howard Street Theatre Improvement project. For Action Approved on Consent Agenda (A3.2) Change Order No. 1 to the Architectural/Engineering Services for the Gibbs Morrison Site Improvement Project with Teska Associates, Inc. City Council authorized the City Manager to execute Change Order No. 1 with Teska Associates, Inc. (627 Grove Street, Evanston, Illinois) for Architectural/Engineering Services for the Gibbs Morrison Site Improvement Project (RFP 16-04) in the amount of $3,640.00. This change order increases the contract amount from $77,641.00 to $81,281.00 and extends the contract deadline by 457 days, from June 30, 2017 to September 30, 2018. Funding for this change order is from the Capital Improvement Fund 2017 General Obligation Bonds, which has remaining balance of $49,505 budgeted for this project. For Action Approved on Consent Agenda 16 of 549 (A3.3) Change Order No. 1 to the Engineering Services Contract for the Fountain Square Renovation Project with Christopher B. Burke Engineering, Ltd. City Council authorized the City Manager to approve Change Order No. 1 to the existing engineering services contract for the Fountain Square Renovation Project (RFP 15-68) with Christopher B. Burke Engineering, Ltd (9575 W. Higgins Road, Suite 600, Rosemont, IL 60018), in the amount of $197,906.79. This will modify the existing agreement amount from $747,531.89 to $945,438.68 and extend the contract deadline from June 30, 2018 to September 30, 2018. Funding is available from the Washington National TIF. Additional details can be found in the corresponding transmittal memorandum. For Action Passed 8-1 Alderman Suffredin voted “No” Watch (A3.4) Renewal of Single Source Service Agreement with Motorola, Inc. for the 911 Center City Council authorized the City Manager to approve the renewal of the annual single source Service Agreement with Motorola, Inc. (1309 East Algonquin Road., Schaumburg, IL 60196) for the amount of $84,740.56. The Agreement is effective from January 1, 2018 through December 31, 2018. Funding will be provided by the Emergency Telephone System account 205.22.5150.62509 (Service Agreements & Contracts) with a Budget of $87,000.00. For Action Approved on Consent Agenda (A3.5) Twelve Month Divvy Contract Extension with Motivate International Inc. City Council authorized the City Manager to execute a 12 month extension with Motivate International Inc. (“Motivate”) to continue to operate the Divvy bicycle sharing system in Evanston. This is a partial extension of one of two 5 year extensions contemplated in the Operator Agreement between the City and Motivate (attached to this memorandum). The 12 month extension will provide additional time for Motivate and the City to build Evanston-based ridership, complete potential station relocations, and better support this mode of transportation. The adopted FY2018 budget included $304,000 for Divvy (Account: 505.19.7005.62603). For Action Passed 7-2 Ald. Braithwaite and Ald. Fleming voted “No” Watch 17 of 549 (A3.6) Use of Local Employment Program Penalty Fees – Evanston Firefighter Application Fees City Council approved spending Local Employment Program penalties for workforce development by financing the application and Candidate Physical Ability Test fees for local Evanston firefighter applicants. For Action Approved on Consent Agenda (A4) Resolution 3-R-18, Authorizing Payments Relating to the FY 2018 Capital Improvement Plan Projects be Reimbursed by the Subsequent 2018 General Obligation Bond Issuance City Council adopted Resolution 3-R-18, authorizing payments relating to FY 2018 Capital Improvement Plan project expenditures up to $20,777,000 be reimbursed by the subsequent 2018 General Obligation bond issuance. For Action Approved on Consent Agenda (A5) Resolution 5-R-18, Agreement with the Cook County Assessor’s Office for Access to a Geographic Information System City Council adopted Resolution 5-R-18, authorizing the City Manager to sign an agreement with the Cook County Assessor’s Office (Assessor) for access to Geographic Information System (GIS) data. Information Technology receives an annual update of the Assessor’s database which is used to augment the City’s GIS database. For Action Approved on Consent Agenda (A6) Resolution 4-R-18, Approval and Execution of the First Addendum to the Water Supply Agreement with Morton Grove-Niles Water Commission City Council adopted Resolution 4-R-18, authorizing the approval and execution of the first addendum to the water supply agreement between the City of Evanston and the Morton Grove-Niles Water Commission. The addendum memorializes the relevant changes in status/contract assignment, and confirms that the water commission assumes the same contractual obligations owed to the City under the 2017 water supply agreement. For Action 18 of 549 Approved on Consent Agenda (A7) Ordinance 6-O-18, Real Estate Contract for the Sale of Certain City-Owned Real Property at 623-627 ½ Howard Street to Little Piggy, LLC City Council adopted Ordinance 6-O-18, authorizing the City Manager to enter into a real estate contract for the sale of certain City-owned real property located at 623-627½ Howard Street to Little Piggy, LLC. A two-thirds majority of City Council is required to adopt Ordinance 6-O-18. For Introduction and Action Approved on Consent Agenda (A8) Ordinance 8-O-18, Amending City Code Section 10-11-16(B) “Designation of Truck Routes and Bike Routes” City Council adopted Ordinance 8-O-18, which would amend Section 10-11-16, Schedule XVI (B) 1 and (B) 2 of the City Code to amend designated bike routes on Chicago Avenue, Sheridan Road, Sheridan Place, Euclid Place, Ingleside Place, Central Street, Church Street and Davis Street. The ordinance would amend the title of Schedule XVI (B) 1 and (B) 2 to correct an error. Funding for additional signage and markings were included as part of the related CIP projects. For Action Approved on Consent Agenda (A9) Ordinance 1-O-18, Amending City Code Section 4-4-2, “Amendments,” Requiring Fire Protection Systems Testing Records on an Annual Basis City Council adopted Ordinance 1-O-18, amending City Code Section 4-4-2, “Amendments,” requiring fire protection systems testing records on an annual basis. For Action Approved on Consent Agenda (P1) Vacation Rental License for 710 Madison Street City staff recommends City Council approval of a Vacation Rental License for the property located at 710 Madison Street. The Vacation Rental meets all of the Standards and Procedures for license approval. For Action Item held in committee until February 26, 2018 Motion: Ald. Wynne Watch 19 of 549 (P2) Ordinance 7-O-18, Granting a Special Use for a Type 2 Restaurant, Colectivo Coffee, at 716 Church Street City Council adopted Ordinance 7-O-18 granting special use approval for a Type 2 Restaurant, Colectivo Coffee, at 716 Church Street in the D3 Downtown Core Development District. The applicant has complied with all zoning requirements and meets all of the standards for a special use for this district. For Introduction and Action Approved on Consent Agenda (P3) Ordinance 13-O-18, Granting a Special Use for the Expansion of a Religious Institution and Major Zoning Relief for a Third Story Addition at 2014 Orrington Avenue City Council adopted Ordinance 13-O-18 granting special use approval for the expansion of a Religious Institution, Lubavitch Chabad of Evanston, and major zoning relief for a third story addition, in the R1 Single Family Residential District. The applicant has complied with all zoning requirements and meets all of the standards for special use and major variations for this district. For Introduction Approved on Consent Agenda (P4) Ordinance 14-O-18, Granting a Special Use for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street The Zoning Board of Appeals and City staff recommend adoption of Ordinance 14-O-18 granting special use approval for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street in the B1 Business District. This recommendation is conditional on the replacement of the building’s glass block windows with unobstructed transparent glass and removal of iron bars on windows and doors. The applicant has complied with all zoning requirements and meets all of the standards for a special use in this district. For Introduction Item held in committee until February 12, 2018 (P5) Ordinance 5-O-18, Granting Special Use Permit for a Planned Development Located at 601 Davis Street The Plan Commission and staff recommend denial of Ordinance 5-O-18 for approval of the Planned Development to construct a 33-story, 318-unit residential building with 7,481 square feet of ground floor commercial 20 of 549 space (including a drive through for a financial institution, Chase Bank) and 176 on-site parking spaces. The applicant is requesting 8 site development allowances. The proposed development exceeds the maximum site development allowances for building height and FAR, therefore, a super-majority (two-thirds) vote by the City Council is required for approval. On January 8, 2018 Ordinance 5-O-18 was continued until January 22, 2018 for Introduction. For Introduction Item failed in Committee (APP1) For Appointment: Plan Commission George Halik For Action Approved on Consent Agenda (APP2) For Re-Appointment: M/W/EBE Development Committee Joshua Gutstein Public Safety Civil Service Commission Mary Erickson For Action Approved on Consent Agenda Call of the Wards Ward 1: No Report Watch Ward 2: No Report Watch Ward 3: 3rd Ward meeting on January 25th at Lincoln school from 7-8:30 pm Watch Ward 4: No Report Watch Ward 5: Congratulated Pastor and Lady Monte-Dillard of First Church of God Christian Life Center for 7 years of service in ministry. Also thanked Daniel Featherson for producing the Westy Award and congratulated the winners including Derick Brown, Bridget Giles, Althea Brown, Lony Wilson, Don Mitchell and Jennifer Ethan. Watch 21 of 549 Ward 6: No Report Watch Ward 7: No Report Watch Ward 8: Thanked St. Francis Hospital for their Martin Luther King celebration. Thanked everyone who came to the last community meeting. Announced they had 4 new building owners and 6 new business owners in the 8th Ward. Thanked City Council for approving the sale of Peckish Pig. Watch Ward 9: Made a referral to staff to provide a report on Open Communities. The report should include the amount of people they served the previous year, including the number and referral made for those clients. Made a second referral for the Hearing Officers for the activity of the previous year, including the hours they worked, the number of cases they had and the amount the City paid them. Watch Adjournment Mayor Hagerty called a voice vote to adjourn the City Council meeting, and by unanimous vote the meeting was adjourned. 22 of 549 CITY COUNCIL REGULAR MEETING CITY OF EVANSTON, ILLINOIS LORRAINE H. MORTON CIVIC CENTER JAMES C. LYTLE COUNCIL CHAMBERS Monday, January 29th, 2018 Present: Alderman Fiske Alderman Revelle Alderman Braithwaite Alderman Rainey Alderman Wynne Alderman Fleming Alderman Wilson Alderman Suffredin Alderman Rue Simmons (9) Absent: Presiding: Mayor Stephen Hagerty Devon Reid City Clerk 23 of 549 Mayor’s Public Announcements Mayor Hagerty proclaimed January 29, 2018 as Blake Peter’s Day in the City of Evanston in recognition of Blake Pater for his buzzer-beating game winning shot against Maine South High School Hawks basketball team and delivering a victory for ETHS basketball team. Watch City Manager’s Public Announcements City Manager Wally Bobkiewicz invited Tim Rose, Director of the Fleetwood-Jourdain Theater to talk about events happening in February for Black History month in the City of Evanston. Manager Bobkiewicz also announced the placement of “All People Are Welcome” signs across all City facilities in various languages. Watch City Clerk’s Communications City Clerk announced the availability of Mail Ballot Applications located in the City Clerk’s Office. Citizens can deliver the forms to the Clerk’s Office or mail them to the Cook County Clerk’s office before March 15th. Early voting starts March 5-19 in the Civic Center in Room G300. The City Clerk encouraged residents to step into the office and volunteer on Monday, Wednesday and some Saturdays to encourage people to participate in the election. Watch Public Comment Len Larkin Asked City Council to consider a resolution to give the city control over rent control. Watch Doug Sharp Presented City Council with a proposal for affordable housing. Watch Michael Deneroff Northwestern Student Government member who spoke about the unaffordability of housing for students living in Evanston. Watch Jillian Gilburne Northwestern Student Government member who share scenarios of what is happening to students looking for a place to live. Watch Meilynn Shi Northwestern student who proposed the City of Evanston change the occupancy limit in rental units. Watch 24 of 549 Peter Dalton Spoke about the inclusionary housing ordinance. Watch Bessie Simmons Shared her story about how affordable housing is important to her and others in the community. Watch Sue Loellbach Sue works for Connections for the Homeless and was at the City Council meeting representing Joining Forces for Affordable Housing. She encouraged that the City of Evanston put a plan that identifies what we can do but also strategies to obtaining resources for affordable housing Watch Tina Paden Wants the City to provide assistance to landlords who provide affordable housing to residents. Watch Carlis Sutton Addressed his concerns about Pilot Landlord Rehabilitation Assistance Program and Evanston Rental Program to Address Affordable Housing Needs Watch Sarah Vanderwicken Suggested that data collected on affordable housing be used to better distribute affordable housing units in the community Watch Betty Ester Invited City Council members, staff and the public to attend a presentation on civilian police oversight. It will be held on February 8th at 7 p.m. at Family Focus. Watch Doreen Price Asked City Council to appropriate funds to assist senior citizens in evanston to rebuild their homes so they can rent out the units Watch Prisila Giles Wanted the City to find better solutions to fit the housing needs of those in low and fix incomes. Watch Special Order of Business (SP1) Affordable Housing Work Plan Staff will update and present City Council with activities undertaken since January 1, 2018 related to affordable housing. Tasks were referred to committees during City Council’s discussion of the Affordable Housing White Paper on October 30, 2017. For Action: Accept and Place on File Approved Watch 25 of 549 (SP2) Zoning Change to Allow Rental of Accessory Dwelling Units to Non-Family Members City Council made a referral to the Plan Commission to change zoning to allow rental of existing accessory dwelling units to individuals who are not members of the family living in the primary dwelling unit. For Action: Refer to Plan Commission Item referred to Plan Commission for zoning changes without affordability restrictions on ADUs Passed 9-0 Watch (SP3) Pilot Landlord Rehabilitation Assistance Program Staff requests consideration of the Pilot Landlord Rehabilitation Assistance Program to support improvements and repairs for rental units that are committed to be rented to households earning 60% of AMI. Staff recommends allocation of $200,000 for the 2018 fiscal year. At its meeting on January 8, 2018, the Administrative and Public Works Committee directed staff to develop a pilot rehabilitation assistance program for local landlords who currently provide rental units at affordable rates but need funds to improve their properties. Funding would be from the City’s Affordable Housing Fund, 250.21.5465.65535. The Affordable Housing Fund has a current uncommitted cash balance of approximately $800,000. For Action Direction provided to staff for revisions; item referred to February 26th Administration & Public Works committee Motion: Ald. Wilson Watch (SP4) Rooming Houses Research At its meeting on January 8, 2018, the Planning and Development Committee requested a white paper on rooming houses. Staff seeks direction on next steps. For Discussion Direction provided to staff Item referred to April 9th Planning and Development Committee Watch (SP5) Steps Toward Homeownership: First-Time Homebuyer Programs, Mortgage Products and Other Strategies to Expand Homeownership for Moderate and Middle Income Households Staff is providing information requested by the City Council at the October 30, 2017 City Council and January 8, 2018 Administration and Public Works meetings about homeownership assistance programs that are currently available. Staff has prepared a memorandum that reviews Watch 26 of 549 mortgage products that combine acquisition and rehab of homes and first time homebuyers programs, and City of Evanston homeownership programs provided in past years. Staff also includes potential new strategies to expand homeownership for moderate and middle income households for consideration by City Council. For Discussion Item referred to February 26th Administration & Public Works Committee (SP6) Evanston Rental Program to Address Affordable Housing Needs At its meeting on October 30, 2017, City Council referred the Evanston Rental Program proposed by Alderman Rainey to the Administration and Public Works Committee. Staff provided a memo for discussion on January 17, 2018. Alderman Rainey stressed the importance of rental assistance as a strategy in the City’s Affordable Housing Plan, but that implementation of the program should be held until the City receives additional funding from developer contributions. At the January 22, 2018 Planning and Development Committee meeting, Alderman Revelle asked that work with McKinney-Vento families, who are homeless and have school age children, be included in the Affordable Housing Work Plan. Staff seeks direction on next steps for this program. Initial funding of $1,200,000 would be from developer contributions to the Affordable Housing Fund, 250.21.5465.65535. Subsequent funding could be from the AHF or other sources to be identified. For Discussion Item held until April 30th IHO subcommittee addresses issue of funding for AHF Call of the Wards Ward 1: Thanked the Police and Firefighters who responded to an incident at the Sherman Plaza parking garage. Made a reference to A&PW for security fence at Sherman Ave. parking garage. Reminded 1st Ward residents that there will be a possibility of funding the Northlight Farpoint project on Wednesday January 31st at the Economic Development meeting. Watch 27 of 549 Ward 2: No Report Watch Ward 3: On February 1st Ald. Wynne will have her office hours from 7-10 a.m. at Brothers K Watch Ward 4: No Report Watch Ward 5: Made referral to the Economic Development department for a white paper on how code base helps or hinders development. Watch Ward 6: No Report Watch Ward 7: No Report Watch Ward 8: No Report Watch Ward 9: Sent her condolences to the family of a 9th Ward resident who lost his life in a fire, as well as the firefighters who assisted from Evanston as well as Niles, Wilmett and Morton Grove. Watch Adjournment Mayor Hagerty called a voice vote to adjourn the City Council meeting, and by unanimous vote the meeting was adjourned. Ald. Wilson led City Council into Executive Session. 28 of 549 ADMINISTRATION & PUBLIC WORKS COMMITTEE Monday, February 12, 2018 6:00 p.m. Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Evanston James C. Lytle Council Chambers AGENDA I. DECLARATION OF A QUORUM: ALDERMAN RAINEY, CHAIR II. APPROVAL OF MINUTES OF REGULAR MEETING OF JANUARY 22, 2018 III. ITEMS FOR CONSIDERATION (A1) Payroll – January 8, 2018 through January 21, 2018 $ 3,193,912.48 (A2.1) FY 2017 Bills List – February 13, 2018 $ 3,359,819.15 FY 2018 Bills List – February 13, 2018 $ 2,973,670.58 Credit Card Activity (not including Amazon purchases), Period ending December 31, 2017 - Bank of America $ 159,115.23 BMO (Beta testing with New Purchasing cards) $ 2,394.26 For Action (A2.2) Amazon Credit Card Activity Period Ending December 31, 2017 $ 10,571.30 For Action (A3.1) Fuel Purchases for Six Months from Gas Depot Oil Company Staff recommends City Council approval of fuel purchases for the first six (6) months of Fiscal Year 2018 in the amount of $450,000.00 from Gas Depot Oil Company (8930 N. Waukegan Road, Suite 230, Morton Grove, IL 60053). The Gas Depot Oil Company is the current Northwest Municipal Conference Bid winner through July 5, 2018 for all grades and types of fuels that are utilized by city vehicles. Funding for this purchase will be from the Major Maintenance, Materials to Maintain Autos Fund (Account 600.19.7710.65035), with a FY18 budget of $1,100,000. Present fuel prices are $2.11/gallon for 87 octane gasoline and $2.40/gallon for bio-diesel. For Action 29 of 549 (A3.2) 2018 New Tire Purchases from Wentworth Tire Service Staff recommends City Council approval of tire purchases for the twelve (12) months in Fiscal Year 2018 in the amount of $75,000.00 from Wentworth Tire Service (300 North York Road, Bensenville, IL). Wentworth Tire Service is an authorized distributor of tires within the Illinois State Contract # 7129. Funding is provided from Fleet Services/Tires and Tubes (Account 600.26.7710.65065), with a FY18 budget of $100,000. $75,000.00 is requested for the purchasing of new tires, and the remaining $25,000.00 of the tire budget is for tire repair services (tire mounting, tire dis-mounting, road repairs, and service calls for the same time period) as a separate contract. For Action (A3.3) One-Year Renewal for Tire Repair Services with Wentworth Tire Service Staff recommends City Council approval for the City Manager to authorize a one (1) year renewal for tire repair and recap services in the amount of $24,672 with Wentworth Tire Service (300 North York Road, Bensenville, IL). This will be the second (2nd) and final renewal on this contract from January 1, 2018 through December 31, 2018. Funding is provided from Fleet Services/Tires and Tubes (Account 600.26.7710.65065), with a FY18 budget of $100,000. For Action (A3.4) One-Year Contract Renewal for Testing, Repair & Certification of Fire Apparatus and Aerial Devices Staff recommends City Council approval of a one year contract extension (RFP 15-30) to Global Emergency Products (1401 N. Farnsworth Avenue, Aurora, IL 60505) in the amount of $72,300.00, to provide the required annual inspections and repairs for heavy fire apparatus vehicles assigned to Evanston Fire Department. This will be the third and final renewal. There is no cost increase from the last renewal. Funding will be from Account 600.19.7710.65060 with a FY18 Budget of $1,050,000. For Action (A3.5) Contract with Structures Construction LLC for Construction Services for the Howard Street Theatre Staff recommends that City Council authorize the City Manager to execute a contract to provide construction services for the Howard Street Theatre with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, IL 60647) in the amount of $1,385,469.00. Funding for this project will be provided from Capital Improvement Program (CIP) Howard-Ridge TIF funds (Account 415.40.4218.65515 – 617016), which has an FY 2018 budget allocation of $1,756,058.00. The Howard Ridge TIF will issue debt and will pay the debt service costs for the architectural and construction costs for this project. For Action 30 of 549 (A3.6) Contract with Carollo Engineers, Inc. for West Plant Filter Study Staff recommends City Council authorize the City Manager to execute a contract for the West Filter Plant Study (RFP 17-58) with Carollo Engineers, Inc. (8600 W. Bryn Mawr Avenue, Suite 900N, Chicago, IL 60631) in the amount of $126,033.00. Funding for the study will be provided from the Water Fund (Account 510.40.4200.62180). This project was budgeted at $150,000.00 in FY 2018. For Action (A3.7) One-Year Renewal Agreement with Harris Computer Systems for NorthStar Utility Billing Software Staff recommends that City Council authorize the City Manager to execute a renewal of the annual sole source maintenance and support agreement for the term March 1, 2018 through February 28, 2019 with Harris Computer Systems (1 Antares Drive, Suite 400, Ottawa, Ontario) for Harris NorthStar Utility Billing software, in the amount of $41,289.90. Funding for this purchase will be from Account 510.40.4225.62340 which has an allocation of $45,000.00. This account has a YTD balance of $183,200.00. For Action (A3.8) Contract with ADS Environmental Services for 2018 Sewer Flow Monitoring Staff recommends that City Council authorize the City Manager to execute a contract for the 2018 Sewer Flow Monitoring (Bid No. 18-03) with ADS Environmental Services (340 The Bridge Street, Suite 204, Huntsville, AL 35806) in the amount of $38,000.00. Funding for this project is from the Sewer Fund, Account 515.40.4531.62180, which has an FY 2018 budget of $75,000.00. For Action (A3.9) Five-Year Contract with Great Lakes Recycling, Inc. d/b/a Simple Recycling for Collection of Soft Recyclables Staff recommends that City Council authorize the City Manager to execute a five- year contract for residential soft recycling services with Great Lakes Recycling, Inc. d/b/a Simple Recycling, (5425 Naiman Parkway, Solon, OH). The proposal would allow residents of single family homes or buildings of 5 units or less the ability to recycle a multitude of materials on a weekly basis. The services will not require any City funding, as the company will furnish all containers and vehicles needed for curbside pickups. For Action 31 of 549 (A3.10)Approval of the Estimated Annual User Charge for 2018 with the MWRDGC for Disposal of Sludge Generated as Part of the Water Treatment Process Staff recommends City Council approval of the Estimated Annual User Charge for 2018 with the Metropolitan Water Reclamation District of Greater Chicago (MWRDGC) for Disposal of Sludge generated as part of the water treatment process in the amount $180,086.68. Four payments of $45,021.67 will be made beginning in February 2018 and ending November 2018. Funding for this work will be from the Water Fund, Account 510.40.4220.62420. This account has a budget of $300,000.00 allocated for MWRDGC sludge disposal fees. The YTD account balance equals $300,000.00. For Action (A3.11)Contract with Oxcart Permits System, LLC for Online Application and Processing of Oversize and Overweight Truck Permits Staff recommends the City Council authorize the City Manager to execute an on- line application and processing contract for oversize and overweight truck permits with Oxcart Permits System, LLC., (440 W Colfax, Suite 2384, Palatine, IL 60078) pending approval of Ordinance 9-O-18 – Permits for Excessive Weight and Size. Under the agreement, Oxcart will process the applicants permit, issue such permits after staff review and approval of the application, collect the permit fees and service charges from the applicant, and reimburse the City the fees collected on a monthly basis. For Action (A3.12)Revision of Street Sweeping Schedule Public Works Agency staff recommends revising the street cleaning schedule in 2018 to eliminate the special cleaning areas in Zone 4, changing the days that streets in Zone 4 are cleaned to the fourth Tuesday/Wednesday of the month, and reduce the number of residential streets that are cleaned overnight (4AM to 7AM). Staff also recommends revising the street cleaning schedule to a Tuesday/Wednesday schedule for Zone 3 in 2019, Zone 2 in 2020 and Zone 1 in 2021. The estimated cost of $3,000 to purchase stickers to reflect the proposed changes on the existing signs would be funded from Account 100.40.4105.65515/Public Works Agency-Other Improvements with a FY18 Budget of $3,000. For Action (A3.13)Change Order Number 3 to Contract with Thieneman Construction, Inc. for the Water Treatment Plant Reliability Improvements Construction Staff recommends that City Council authorize the City Manager to execute Change Order No. 3 for the Water Treatment Plant Reliability Improvements Project with Thieneman Construction, Inc. (TCI) (17219 Foundation Parkway, Westfield, IN 46074) for a deduction of $4,531.44 to the current contract amount to account for various minor changes to the work throughout the construction. This change order will decrease the total contract amount from the current contract price of $1,289,721.00 to $1,285,189.56, and extends the date of final completion date from October 29, 2017 to November 17, 2017. For Action 32 of 549 (A3.14)Change Order Number 5 to the Contract with Structures Construction LLC for Dempster Beach Office Renovations Staff recommends City Council authorize the City Manager to execute Change Order 5 to the Dempster Beach Office Renovations contract (Bid No. 17-40) with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, IL) in the amount of $4,830. This will increase the overall contract amount from $276,319 to $281,149. There is no time extension associated with this change order. Funding will be provided from the Capital Improvement Program 2017 General Obligation Bonds, which has a budget of $300,000 for this project (Account No. 415.40.4117.65515 – 617015). For Action (A3.15)Change Order Number 2 to the Contract with SmithGroup JJR for the Church Street South Pier Reconstruction Staff recommends that City Council authorize the City Manager to execute Change Order No. 2 with SmithGroup JJR (35 E. Wacker, Suite 2200, Illinois, 60601), for Engineering Services for the Church Street South Pier Reconstruction Project (RFP 16-13) in the amount of $8,000. This change order increases the contract amount from $90,500.00 to $98,500.00 and extends the contract deadline by 455 days, from December 31, 2017 to March 31, 2019. Funding will be provided from the Capital Improvement Program 2018 General Obligation Bonds (Account 415.40.4118.62145 – 418017). This project was budgeted at $625,000 in FY 2018. For Action (A4) Resolution 9-R-18, Authorizing the Execution and Approval of A Memorandum of Understanding between the City and the Morton Grove/Niles Water Commission Staff recommends City Council adoption of Resolution 9-R-18, authorizing the approval and execution of the attached Memorandum of Understanding between the City of Evanston and the Morton Grove-Niles Water Commission for the construction and operation of an intermediate booster pump station located at 2525 Church Street. For Action (A5) Resolution 2-R-18, Approving Release of Certain Closed Session Minutes Staff recommends City Council approval of Resolution 2-R-18, releasing certain closed session meeting minutes and finding that a need still exists for confidentiality as to the remaining minutes. The City is furthering its efforts to provide access to information and openness in government through the appropriate release of closed session minutes of the City Council. For Action (A6) Resolution 6-R-18, Authorizing the Appointment of an Interim Chief Financial Officer and Interim Treasurer for the City of Evanston Staff recommends City Council adopt Resolution 6-R-18, appointing Ashley King as Interim Chief Financial Officer and Interim Treasurer. For Action 33 of 549 (A7) Ordinance 19-O-18, Updating Authorized Signatories and Financial Institutions for Deposits/Investments of City Funds Staff recommends City Council adopt Ordinance 19-O-18, adding Ashley King, Budget Manager and Interim Chief Financial Officer/Treasurer, and Andrew Villamin, Accounting Manager, as a depository signature. For Introduction (A8) Ordinance 20-O-18, Amending City Code to Allow for One-Way Traffic Flow During Willard School Drop-Off and Pick-Up Hours on Hurd Street and Central Park Avenue Staff recommends City Council adoption of Ordinance 20-O-18, amending City Code Section 10-11-4, Schedule IV (A) to establish one-way south traffic on Hurd Street between Isabella Street and Park Place, and one-way north traffic on Central Park Avenue between Park Place and Isabella Street adjacent to Willard Elementary School during drop-off and pick-up hours. Funding for signage will be through the General Fund-Traffic Control Supplies (Account 100.40.4520.65115), with a FY 2018 budget of $58,000. For Introduction (A9) Ordinance 9-O-18, Amending City Code Section 10-1-9-4, “Permits for Excessive Weight and Size” Staff recommends that City Council adopt Ordinance 9-O-18, amending Section 10-1-9-4, of the City Code to establish permits and applicable fees for excessive vehicle weight and size in accordance with limitations set forth in 625-ILCS 5/15 - 100 of the Illinois Vehicle Code. Staff recommends suspension of rules for Introduction and Action of this Ordinance at the February 12, 2018 City Council meeting. For Introduction and Action (A10) Ordinance 10-O-18, Amending City Code to Include Civil Restitution City staff recommends City Council adoption of Ordinance 10-O-18 to amend City Code Subsection 1-4-1, “General Penalties,” to include civil restitution by order of Court. This ordinance adds civil restitution to the penalties available for City Code violations, and allows a Court to order restitution beyond the maximum fine amount. Civil restitution may only be ordered by a Court after a finding of guilt or a guilty plea by a defendant. For Introduction (A11) Ordinance 23-O-18, Amending City Code Section 3-4-6(D) to Decrease the Number of Class D Liquor Licenses for Yahala Inn Staff recommends City Council adoption of Ordinance 23-O-18, amending City Code Subsection 3-4-6-(D) to decrease the number of authorized Class D liquor licenses from fifty-one (51) to fifty (50) for 811 Church LLC dba Yahala Inn, as the business is closed. Staff recommends suspension of the rules for Introduction and Action at the February 12, 2018 City Council meeting. For Introduction and Action 34 of 549 (A12) Ordinance 24-O-18, Amending City Code Section 3-4-6(D) to Increase the Nubmer of Class D Liquor Licenses for Good to Go Local Liquor Commissioner recommends City Council adoption of Ordinance 24- O-18, amending City Code Subsection 3-4-6-(D) to increase the number of Class D Liquor Licenses from fifty (50) to fifty-one (51) and permit issuance of a Class D license to Good to Go Jamaican Cuisine, LLC dba Good to Go located at 711 Howard Street. For Introduction (A13) Ordinance 26-O-18, Amending City Code Section 3-4-6(F) to Increase the Number of Class F Liquor Licenses for the Target Store located at 1616 Sherman Avenue Local Liquor Commissioner provides a recommendation to City Council regarding the adoption of Ordinance 26-O-18, amending City Code Subsection 3-4-6-(F) to increase the number of authorized Class F liquor licenses from nine (9) to ten (10), and permit issuance of a Class F license to Target Corporation dba Target Store T3283 located at 1616 Sherman Avenue. For Introduction (A14) Ordinance 28-O-18, Amending City Code Section 10-11-1 Reducing the Speed Limit on Ridge Avenue between Howard Street and Emerson Street from 30 MPH to 25 MPH Staff recommends that City Council adopt Ordinance 28-O-18 to reduce the speed limit on Ridge Avenue between Emerson Street and Howard Street to 25 mph. Staff also recommends the City Council authorize the City Manager to: 1) direct the Evanston Police Department to provide targeted enforcement of traffic regulations within the Ridge Avenue Corridor, and 2) implement split phasing of the traffic signals at the Ridge/Lake intersection on a trial basis. Funding for the estimated $10,000 to implement the split phasing of the traffic signals at the Ridge / Lake Intersection will be from Account 100.40.4520.65115, which has an FY 2108 budget allocation of $58,000. Staff further recommends suspension of rules for Introduction and Action at the February 12, 2018 City Council meeting. For Introduction and Action IV. ITEMS FOR DISCUSSION (APW1)2017 Sidewalk Service Inquiries Staff recommends that City Council review the updated analysis of the sidewalk inquiries received by the City’s 311 department in 2017 and request direction. For Discussion V. COMMUNICATIONS VI. ADJOURNMENT 35 of 549 Administration and Public Works Committee Meeting Minutes of January 22, 2018 James C. Lytle Council Chambers – 6:00 p.m. Lorraine H. Morton Civic Center MEMBERS PRESENT: A. Rainey, T. Suffredin, R. Simmons, C. Fleming MEMBERS ABSENT: P. Braithwaite, STAFF PRESENT: W. Bobkiewicz, A. King, G. Farrar, E. Storlie, D. Stoneback, L. Biggs, M. Hernandez, S. Flax, L. Hemingway, DC Barnes, T. Nunez, S. Levine, P. Polinski PRESIDING OFFICIAL: Ald. Rainey I. DECLARATION OF A QUORUM: ALDERMAN RAINEY, CHAIR A quorum being present, Ald. Rainey called the meeting to order at 6:04p.m. II. APPROVAL OF MINUTES OF REGULAR MEETING OF JANUARY 8, 2017 Ald. Fleming moved to accept the Minutes of January 8, 2017 A&PW meeting as submitted, seconded by Ald. Rue Simmons. The Minutes of the January 8, 2017 A&PW meeting were approved unanimously 4-0. III. ITEMS FOR CONSIDERATION (A1) Payroll – December 25, 2017 through January 07, 2018 $ 2,948,470.31 (A2) Bills List – January 23, 2018 FY: 2017 $ 2,084,030.72 FY: 2018 $ 616,587.34 For Action Ald. Suffredin moved to recommend approval of the City of Evanston Payroll December 25, 2017 through January 07, 2018 in the amount of $2,948,470, FY 2017 Bills List dated January 23, 2018 in the amount of $2,084,030.72 and FY 2018 Bills List dated January 23, 2018 in the amount of $616,587.34, seconded by Ald. Rue Simmons. The Committee voted unanimously 4-0 to approve the payrolls and bills. (A3.1) Contract for Asbestos Abatement at 721-723 Howard Street with Cove Remediation, LLC Staff recommends City Council authorize the City Manager to execute a contract for the Asbestos Abatement at 721-723 Howard Street (Bid 18-05) with Cove Remediation, LLC (5316 W. 12th Street, Alsip, IL), in the amount of $38,000. DRAFT - NOT APPROVED 36 of 549 Funding will be provided from the Howard Ridge TIF (Account 415.40.4218.65515-617016), which has $1,730,000 budgeted for the Howard Street Theatre Improvement project. For Action Ald. Suffredin moved to recommend City Council authorize the City Manager to execute a contract for the Asbestos Abatement at 721-723 Howard Street (Bid 18-05) with Cove Remediation, LLC (in the amount of $38,000, seconded by Ald. Fleming. At Ald. Suffredin’s inquiry, Bureau Chief Lara Biggs explained that this is a City- owned building and asbestos must be remediated prior to any use by a tenant. The asbestos was discovered in late October/early November. This request is not a change order. The opening bid for the first construction contract will happen later in the week and this will be included in the construction cost estimate. After discussion, the Committee voted unanimously 4-0 to approve the contract. (A3.2) Change Order No. 1 to the Architectural/Engineering Services for the Gibbs Morrison Site Improvement Project with Teska Associates, Inc. Staff recommends that City Council authorize the City Manager to execute Change Order No. 1 with Teska Associates, Inc. (627 Grove Street, Evanston, Illinois) for Architectural/Engineering Services for the Gibbs Morrison Site Improvement Project (RFP 16-04) in the amount of $3,640.00. This change order increases the contract amount from $77,641.00 to $81,281.00 and extends the contract deadline by 457 days, from June 30, 2017 to September 30, 2018. Funding for this change order is from the Capital Improvement Fund 2017 General Obligation Bonds, which has remaining balance of $49,505 budgeted for this project. For Action Ald. Rue Simmons moved to recommend City Council authorize the City Manager to execute Change Order No. 1 with Teska Associates, Inc. for Architectural/Engineering Services for the Gibbs Morrison Site Improvement Project (RFP 16-04) in the amount of $3,640.00 increasing the contract amount from $77,641.00 to $81,281.00 and extends the contract deadline by 457 days, from June 30, 2017 to September 30, 2018, seconded by Ald. Fleming. At Ald. Fleming’s inquiry, Bureau Chief Biggs explained that the project is anticipated to be complete in the spring. The paver block and landscaping cannot be completed until the weather breaks. The Committee voted unanimously 4-0 to approve the change order. (A3.3) Change Order No. 1 to the Engineering Services Contract for the Fountain Square Renovation Project with Christopher B. Burke Engineering, Ltd. Staff recommends City Council authorize the City Manager to approve Change Order No. 1 to the existing engineering services contract for the Fountain Square Renovation Project (RFP 15-68) with Christopher B. Burke Engineering, Ltd 37 of 549 (9575 W. Higgins Road, Suite 600, Rosemont, IL 60018), in the amount of $197,906.79. This will modify the existing agreement amount from $747,531.89 to $945,438.68 and extend the contract deadline from June 30, 2018 to September 30, 2018. Funding is available from the Washington National TIF. Additional details can be found in the corresponding transmittal memorandum. For Action Ald. Rainey moved to recommend City Council authorize the City Manager to approve Change Order No. 1 to the existing engineering services contract for the Fountain Square Renovation Project (RFP 15-68) with Christopher B. Burke Engineering, Ltd. in the amount of $197,906.79 modifying the existing agreement amount from $747,531.89 to $945,438.68 and extending the contract deadline from June 30, 2018 to September 30, 2018, seconded by Ald. Fleming. At Ald. Suffredin’s inquiry, Bureau Chief Biggs explained that we have had issues with the contractor completing work on time and have issue contract extensions in the past. The City needs to maintain full-time construction observation. She noted that liquidated damages will cover approximately $64,000 of the change order amount. Christopher B. Burke still needs to complete the project closeout and assistance with the computer programming of the fountain. She noted that the construction cost is currently under budget. The fountain is projected to be done and usable by May 1, 2018. She will provide an update in April. After discussion, the Committee voted 3-1 with Ald. Suffredin voting no to approve the change order. (A3.4) Renewal of Single Source Service Agreement with Motorola, Inc. for the 911 Center Staff from the Police Department recommend City Council authorize the City Manager to approve the renewal of the annual single source Service Agreement with Motorola, Inc. (1309 East Algonquin Road., Schaumburg, IL 60196) for the amount of $84,740.56. The Agreement is effective from January 1, 2018 through December 31, 2018. Funding will be provided by the Emergency Telephone System account 205.22.5150.62509 (Service Agreements & Contracts) with a Budget of $87,000.00. For Action Ald. Fleming moved to recommend City Council authorize the City Manager to approve the renewal of the annual single source Service Agreement with Motorola, Inc. for the amount of $84,740.56 effective from January 1, 2018 through December 31, 2018, seconded by Ald. Rue Simmons. The Committee voted 4-0 to approve the renewal agreement. (A3.5) Twelve Month Divvy Contract Extension with Motivate International Inc. Staff recommends that the City Council authorize the City Manager to execute a 12 month extension with Motivate International Inc. (“Motivate”) to continue to 38 of 549 operate the Divvy bicycle sharing system in Evanston. This is a partial extension of one of two 5 year extensions contemplated in the Operator Agreement between the City and Motivate (attached to this memorandum). The 12 month extension will provide additional time for Motivate and the City to build Evanston- based ridership, complete potential station relocations, and better support this mode of transportation. The adopted FY 2018 budget included $304,000 for Divvy (Account: 505.19.7005.62603). For Action Ald. Rue Simmons moved to recommend City Council authorize the City Manager to execute a 12 month extension with Motivate International Inc. (“Motivate”) to continue to operate the Divvy bicycle sharing system in Evanston, seconded by Ald. Fleming. Alds. Fleming and Rue Simmons expressed concerns about the costs to operate Divvy and user activity. Community Development Director Johanna Leonard explained that the City needs a year to monitor ridership. We are working with Divvy to look at some station relocations and also gather feedback from businesses and patterns of use. At Ald. Suffredin’s inquiry, Community Development Director Leonard will look into the possibility of adding service to the 6th ward with news of the Divvy cancellation in Oak Park. At Ald. Fleming’s inquiry, Community Development Director Leonard explained that she is hoping for more ridership through Divvy. Dockless bikes are an option, but needs more review due to safety issues for the rider and how to properly dock the bike. Those issues are being worked through in other communities before they come here. The Committee voted unanimously 4-0 to approve the extension. (A3.6) Use of Local Employment Program Penalty Fees – Evanston Firefighter Application Fees Staff and the Minority, Women & Evanston Based Enterprise Development Committee recommend that City Council approve spending Local Employment Program penalties for workforce development by financing the application and Candidate Physical Ability Test fees for local Evanston firefighter applicants. For Action Ald. Rainey moved to recommend City Council approve spending Local Employment Program penalties for workforce development by financing the application and Candidate Physical Ability Test fees for local Evanston firefighter applicants, seconded by Ald. Rue Simmons. The Committee voted unanimously 4-0 to approve the financing. (A4) Resolution 3-R-18, Authorizing Payments Relating to the FY 2018 Capital Improvement Plan Projects be Reimbursed by the Subsequent 2018 General Obligation Bond Issuance 39 of 549 Staff recommends City Council adoption of Resolution 3-R-18, authorizing payments relating to FY 2018 Capital Improvement Plan project expenditures up to $20,777,000 be reimbursed by the subsequent 2018 General Obligation bond issuance. For Action Ald. Fleming moved to recommend City Council adoption of Resolution 3- R-18, authorizing payments relating to FY 2018 Capital Improvement Plan project expenditures up to $20,777,000 be reimbursed by the subsequent 2018 General Obligation bond issuance, seconded by Ald. Rue Simmons. The Committee voted unanimously 4-0 to adopt the resolution. (A5) Resolution 5-R-18, Agreement with the Cook County Assessor’s Office for Access to a Geographic Information System Staff recommends City Council adoption of Resolution 5-R-18, authorizing the City Manager to sign an agreement with the Cook County Assessor’s Office (Assessor) for access to Geographic Information System (GIS) data. Information Technology receives an annual update of the Assessor’s database which is used to augment the City’s GIS database. For Action Ald. Suffredin moved to recommend City Council adoption of Resolution 5- R-18, authorizing the City Manager to sign an agreement with the Cook County Assessor’s Office (Assessor) for access to Geographic Information System (GIS) data. Information Technology receives an annual update of the Assessor’s database which is used to augment the City’s GIS database, seconded by Ald. Rue Simmons. The Committee voted unanimously 4-0 to adopt the resolution. (A6) Resolution 4-R-18, Approval and Execution of the First Addendum to the Water Supply Agreement with Morton Grove-Niles Water Commission Staff recommends City Council adoption of Resolution 4-R-18, authorizing the approval and execution of the first addendum to the water supply agreement between the City of Evanston and the Morton Grove-Niles Water Commission. The addendum memorializes the relevant changes in status/contract assignment, and confirms that the water commission assumes the same contractual obligations owed to the City under the 2017 water supply agreement. For Action Ald. Suffredin moved recommend City Council adoption of Resolution 4-R- 18, authorizing the approval and execution of the first addendum to the water supply agreement between the City of Evanston and the Morton Grove-Niles Water Commission which memorializes the relevant changes in status/contract assignment, and confirms that the water commission assumes the same contractual obligations owed to the City under the 2017 water supply agreement, seconded by Ald. Rue Simmons. The Committee voted unanimously 4-0 to adopt the ordinance. 40 of 549 (A7) Ordinance 6-O-18, Real Estate Contract for the Sale of Certain City-Owned Real Property at 623-627 ½ Howard Street to Little Piggy, LLC Staff recommends City Council adoption of Ordinance 6-O-18, authorizing the City Manager to enter into a real estate contract for the sale of certain City- owned real property located at 623-627½ Howard Street to Little Piggy, LLC. A two-thirds majority of City Council is required to adopt Ordinance 6-O-18. Alderman Rainey recommends suspension of the rules for Introduction and Action at the January 22, 2018 City Council meeting. For Introduction and Action Ald. Rue Simmons moved to suspend the rules and recommend City Council adopt Ordinance 6-O-18, authorizing the City Manager to enter into a real estate contract for the sale of certain City-owned real property located at 623-627½ Howard Street to Little Piggy, LLC, seconded by Ald. Fleming. Ald. Fleming noted that this purchase includes $200,000 in City assistance being reimbursed. The Committee voted unanimously 4-0 to suspend the rules and adopt the ordinance. IV. ITEMS FOR DISCUSSION (APW1)Ridge Avenue Corridor – Church Street to Howard Street Staff will present and discuss traffic issues occurring in the Ridge Avenue corridor as well as options for consideration. For Discussion PUBLIC COMMENT Dan Joseph, 1510 Greenwood, explained that as a former bus driver the lanes on Ridge are too narrow to accommodate 4 lanes. Chicago has 2 lanes on Ridge south of Howard. He suggested reducing Ridge to one twelve foot lane with one turn lane in the middle. He also asked for crash data on Ridge from Devon to Howard. Bureau Chief Lara Biggs discussed the background, issues and accident history of the Ridge corridor. She expects to continue to see high traffic from the Sheridan Road traffic. The actions taken between 2016 and 2017 were outlined. The non-traffic related options presented were: a) Reduce the speed limit to 25 mph; b) Continue speed enforcement; c) Install speed cameras (She noted there may be state restrictions on speed cameras); d) Trim trees at traffic signals. The traffic signal related options include: a) split-phase lights at Ridge/Lake and Ridge/Greenleaf that could be done in-house by City staff for $10,000 per intersection as a short-term pilot; b) Hire a consultant to perform additional analysis at a cost of up to $100,000. At Ald. Suffredin’s inquiry, Bureau Chief Biggs will look into the option of creating three twelve foot lanes with a reversible lane. 41 of 549 At Ald. Rainey’s inquiry, Bureau Chief Biggs noted that she has no recent conversations with the Preservation Commission about mast-arm signals. She explained that the Illinois Depart of Transportation estimates a 25% reduction in accidents is probable. Ald. Fleming expressed support of mast-arm signals. She asked for the impact of split-phase lights to determine the negative and positive implications. Bureau Chief Biggs will come back to full Council with specific recommendations in February. (APW2)2017 Sidewalk Complaints Staff recommends that City Council review the analysis of the sidewalk complaints received by the City’s 311 department in 2017 and request direction. For Discussion Acting Chief Financial Officer Ashley King presented the sidewalk complaint analysis for 2017. Ald. Fleming asked staff to return to Committee with the status of all the requests (sidewalk patched, gave information on 50/50 sidewalk program, etc). (APW3)Pilot Landlord Rehabilitation Assistance Program At its meeting on January 8, 2018, the Administrative and Public Works Committee instructed staff to develop a pilot rehabilitation assistance program for local landlords who currently provide rental units at affordable rates but need funds to improve their properties. Staff seeks feedback and direction from the Committee on the proposed program. For Discussion PUBLIC COMMENT Tina Paden owns 15 affordable units with 53 occupants. Her units need roofs and windows. Her last property tax installment was $8,000 and she could use some assistance to make repairs. Ald. Rue Simmons would like to create an income qualifying model similar to the Economic Development Committee’s Storefront Modernization Program. Ald. Rainey recommended referring this item to the January 29, 2018 Affordable Housing meeting. Ald. Fleming would like to extend the loan forgiveness to more than the 5 years indicated in the proposal. (APW4)Steps Toward Homeownership: History of City of Evanston Homeownership Programs Staff outlines the City of Evanston’s support for homeownership in past years to provide context as City Council considers potential strategies to expand homeownership for moderate and middle income households. For Discussion 42 of 549 Ald. Rainey recommended referring this item to the January 29, 2018 Affordable Housing meeting. V. COMMUNICATIONS VI. ADJOURNMENT Ald. Rue Simmons moved to adjourn the meeting, seconded by Ald. Fleming. The meeting adjourned at 7:21pm. 43 of 549 To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Ashley King Interim Chief Financial Officer Tera Davis, Accounts Payable Coordinator Subject: City of Evanston Payroll and Bills Date: February 7, 2018 Recommended Action: Staff recommends approval of the City of Evanston Payroll and Bills List. Summary: Payroll – January 8, 2018 through January 21, 2018 $ 3,193,912.48 (Payroll includes employer portion of IMRF, FICA, and Medicare) Bills List – February 13, 2018 FY: 2017 $ 3,359,819.15 General Fund Amount – Bills list $413,590.32 FY: 2018 $ 2,973,670.58 General Fund Amount – Bills list $375,123.01 $ 97.50 $375,220.51 TOTAL AMOUNT OF BILLS LIST & PAYROLL $ 9,527,402.21 *Advanced checks are issued prior to submission of the Bills List to the City Council for emergency purposes, to avoid penalty, or to take advantage of early payment discounts. Credit Card Activity – Period Ending December 31, 2017 Bank of America $ 159,115.23 BMO (Beta testing with New Purchasing cards) $ 2,394.26 Attachments: Bills List December Credit Card Transactions For City Council meeting of February 12, 2018 Items A1 - A2.1 Business of the City by Motion: City Payroll and Bills For Action Memorandum 44 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY2017 100 GENERAL FUND 1505 CITY MANAGER 62295 WALTER BOBKIEWICZ REIMBURSEMENT: CITY MANAGER MEETING EXPENSE 2,090.47 1505 CITY MANAGER Total 2,090.47 1510 PUBLIC INFORMATION 62506 NORTHWESTERN UNIVERSITY FEDERAL WORK STUDY OCTOBER 1, 2017 TO DECEMBER 31, 2017 255.00 1510 PUBLIC INFORMATION Total 255.00 1555 FINANCIAL ADMINISTRATION 65095 OFFICE DEPOT OFFICE SUPPLIES -39.99 1555 FINANCIAL ADMINISTRATION Total -39.99 1560 REVENUE & COLLECTIONS 62449 PROFESSIONAL ACCOUNT MANAGEMENT LLC *PROCESSING AND MANAGEMENT OF PARKING TICKET AND PAYMENTS 128,767.78 62449 PROFESSIONAL ACCOUNT MANAGEMENT LLC PROCESSING AND MANAGEMENT OF PARKING TICKETS AND PAYMENTS 87,515.82 62449 SECRETARY OF STATE DRIVER SERVICES DEPARTMENT SECRETARY OF STATE SUSPENSION FEE 20.00 1560 REVENUE & COLLECTIONS Total 216,303.60 1580 COMMUNITY ARTS 66040 MUSICAL OFFERING THE ARTS COUNCIL GRANT 250.00 1580 COMMUNITY ARTS Total 250.00 1705 LEGAL ADMINISTRATION 52040 ILLINOIS STATE POLICE FINGER PRINTING SERVICES 27.00 62130 WEST GROUP PAYMENT CTR LEGAL RESEARCH 1,030.88 62130 CDM SMITH, INC.WATER CONTRACT CONSULTING 520.00 62130 US LEGAL SUPPORT, INC.DEPOSITION TRANSCRIPT 931.10 62130 ROYAL REPORTING SERVICES, INC.DEPOSITION TRANSCRIPT 126.69 62130 PACER SERVICE CENTER COURT ELECTRONIC RECORDS 80.10 1705 LEGAL ADMINISTRATION Total 2,715.77 1929 HUMAN RESOURCE DIVISION 62270 NORTH SHORE ENH OMEGA EMPLOYEE TESTING SERVICES-ENH-OMEGA 7,068.00 1929 HUMAN RESOURCE DIVISION Total 7,068.00 1932 INFORMATION TECHNOLOGY DIVI. 62175 IRON MOUNTAIN OSDP INFO TECHNOLOGY INVOICES 711.81 62250 PACE SYSTEMS, INC.INFO TECHNOLOGY INVOICES 4,700.00 62380 XEROX CORP.XEROX INVOICES 586.54 62506 NORTHWESTERN UNIVERSITY FEDERAL WORK STUDY OCTOBER 1, 2017 TO DECEMBER 31, 2017 939.99 65615 COMMUNICATIONS REVOLVING FUND WEB SITE CHARGES NOVEMBER AND DECEMBER 2017 1,350.00 65615 COMMUNICATIONS REVOLVING FUND WEB SITE SERVICES 450.00 1932 INFORMATION TECHNOLOGY DIVI. Total 8,738.34 1941 PARKING ENFORCEMENT & TICKETS 62451 NORTH SHORE TOWING IMMOBILIZATION PROGRAM 9,525.00 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 132.65 1941 PARKING ENFORCEMENT & TICKETS Total 9,657.65 1950 FACILITIES 62225 ANDERSON PEST CONTROL PEST CONTROL 1,090.16 62225 SIMPLEX GRINNELL SHERMAN GARAGE DRY SPRINKLER REPAIR 461.00 62245 SCHNEIDER ELECTRIC BUILDINGS AMERICA CHILLED WATER FLOW SWITCH AT CIVIC CENTER 4,288.00 62509 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 379.00 64005 COMED UTILITIES COMED 138.07 1950 FACILITIES Total 6,356.23 2126 BUILDING INSPECTION SERVICES 62509 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 151.60 65020 SILK SCREEN EXPRESS, INC.CD CLOTHING 480.00 2126 BUILDING INSPECTION SERVICES Total 631.60 2128 EMERGENCY SOLUTIONS GRANT 67110 CONNECTIONS FOR THE HOMELESS 2016/2017 ESG GRANT EXPENSES INCURRED IN NOVEMBER AND DECEMBER 20,226.13 67110 CONNECTIONS FOR THE HOMELESS ESG DISBURSEMENT FOR EXPENSES INCURRED IN DECEMBER 2017 5,335.68 67110 CONNECTIONS FOR THE HOMELESS ESG GRANT DISBURSEMENT FOR EXPENSES INCURRED IN NOVEMBER 2017 5,026.63 67110 CONNECTIONS FOR THE HOMELESS ESG GRANT DISBURSEMENT FOR EXPENSES INCURRED IN OCTOBER 2017 2,559.70 2128 EMERGENCY SOLUTIONS GRANT Total 33,148.14 2205 POLICE ADMINISTRATION 64005 COMED UTILITIES COMED 208.91 2205 POLICE ADMINISTRATION Total 208.91 2210 PATROL OPERATIONS 62490 ILLINOIS TOLLWAY TOLLS 214.19 65020 VCG UNIFORM UNIFORM 1,479.80 65020 VCG UNIFORM UNIFORM - NEW RECRUIT 8,663.07 65020 VCG UNIFORM UNIFORM - VEST 815.00 65020 KIESLER POLICE SUPPLY, INC.UNIFORM - VEST 2,038.00 2210 PATROL OPERATIONS Total 13,210.06 2255 OFFICE-PROFESSIONAL STANDARDS 62770 NET TRANSCRIPTS, INC.TRANSCRIPTS 175.50 2255 OFFICE-PROFESSIONAL STANDARDS Total 175.50 2285 PROBLEM SOLVING TEAM 62245 WHEEL & SPROCKET BIKE REPAIR/SERVICE 697.87 2285 PROBLEM SOLVING TEAM Total 697.87 145 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY2017 2305 FIRE MGT & SUPPORT 65050 HASTINGS AIR-ENERGY CONTROL EXHAUST REPAIRS 734.90 2305 FIRE MGT & SUPPORT Total 734.90 2315 FIRE SUPPRESSION 53675 ANDRES MEDICAL BILLING AMBULANCE SERVICES - DECEMBER 2017 10,237.25 53675 ANDRES MEDICAL BILLING AMBULANCE SERVICES - OCTOBER 2017 10,302.03 53715 MONICA ROBERTSON REFUND: ALARM REGISTRATION 250.00 62509 AIR ONE EQUIPMENT HYDRO TESTS 571.50 2315 FIRE SUPPRESSION Total 21,360.78 2435 FOOD AND ENVIRONMENTAL HEALTH 61055 GOV TEMPS USA, LLC TEMPORARY EMPLOYEES HEALTH 1,372.70 62509 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 151.60 2435 FOOD AND ENVIRONMENTAL HEALTH Total 1,524.30 3020 REC GENERAL SUPPORT 62490 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 94.75 3020 REC GENERAL SUPPORT Total 94.75 3025 PARK UTILITIES 64005 COMED UTILITIES COMED 331.23 64005 DYNEGY UTILITIES-DYNEGY 2,245.35 64015 NICOR UTILITIES NICOR 108.03 3025 PARK UTILITIES Total 2,684.61 3030 CROWN COMMUNITY CENTER 62505 MICHELLE A. VAN DER KARR DANCE INSTRUCTOR 860.00 64005 DYNEGY UTILITIES-DYNEGY 3,512.61 3030 CROWN COMMUNITY CENTER Total 4,372.61 3035 CHANDLER COMMUNITY CENTER 62506 NORTHWESTERN UNIVERSITY WORK STUDY STAFF 1,185.68 64005 DYNEGY UTILITIES-DYNEGY 1,301.16 3035 CHANDLER COMMUNITY CENTER Total 2,486.84 3040 FLEETWOOD JOURDAIN COM CT 64005 DYNEGY UTILITIES-DYNEGY 3,147.32 65095 OFFICE DEPOT OFFICE SUPPLIES 76.86 3040 FLEETWOOD JOURDAIN COM CT Total 3,224.18 3055 LEVY CENTER SENIOR SERVICES 62245 NEIL ESTRICK GALLERY, LLC KILN VENT REPAIR 150.00 62695 AMERICAN CHARGE SERVICE DEC TAXI REIMBURSEMENT 1,360.00 64005 DYNEGY UTILITIES-DYNEGY 3,925.64 3055 LEVY CENTER SENIOR SERVICES Total 5,435.64 3080 BEACHES 62490 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 37.90 64005 DYNEGY UTILITIES-DYNEGY 107.83 3080 BEACHES Total 145.73 3095 CROWN ICE RINK 62490 LAUNDRY WORLD PRE SCHOOL LAUNDRY 122.00 62490 SOPHIA LAWRENCE ICE MONITORING 632.50 62490 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 18.95 64005 DYNEGY UTILITIES-DYNEGY 10,537.83 65025 CITY OF EVANSTON - PETTY CASH PETTY CASH 163.26 65110 CITY OF EVANSTON - PETTY CASH PETTY CASH 40.16 3095 CROWN ICE RINK Total 11,514.70 3215 YOUTH ENGAGEMENT DIVISION 62490 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 56.85 3215 YOUTH ENGAGEMENT DIVISION Total 56.85 3605 ECOLOGY CENTER 64005 DYNEGY UTILITIES-DYNEGY 426.58 65110 CITY OF EVANSTON - PETTY CASH PETTY CASH 126.00 3605 ECOLOGY CENTER Total 552.58 3610 ECO-QUEST DAY CAMP 65025 CITY OF EVANSTON - PETTY CASH PETTY CASH 9.94 3610 ECO-QUEST DAY CAMP Total 9.94 3710 NOYES CULTURAL ARTS CENTER 64005 DYNEGY UTILITIES-DYNEGY 1,545.57 3710 NOYES CULTURAL ARTS CENTER Total 1,545.57 3720 CULTURAL ARTS PROGRAMS 62506 NORTHWESTERN UNIVERSITY JULY 1 THRU DECEMBER 31 WORK STUDY 2,892.09 3720 CULTURAL ARTS PROGRAMS Total 2,892.09 4105 PUBLIC WORKS AGENCY ADMIN 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 1,648.65 65095 OFFICE DEPOT OFFICE SUPPLIES 78.31 4105 PUBLIC WORKS AGENCY ADMIN Total 1,726.96 246 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY2017 4320 FORESTRY 61060 NORTHWESTERN UNIVERSITY FEDERAL WORK STUDY OCTOBER 1, 2017 TO DECEMBER 31, 2017 438.00 284503 62185 JUDY POLLOCK 2017 CHI CAL GRANT PROGRAM EXPENSES 7,000.00 4320 FORESTRY Total 7,438.00 4400 CAPITAL PLANNING & ENGINEERING 62315 FEDERAL EXPRESS CORP.SHIPPING 7.65 4400 CAPITAL PLANNING & ENGINEERING Total 7.65 4520 TRAF. SIG.& ST LIGHT MAINT 64006 COMED *UTILITIES COMED 26,408.31 64007 COMED UTILITIES COMED 8,870.15 64008 COMED UTILITIES COMED 1,194.71 64008 DYNEGY UTILITIES-DYNEGY 401.32 4520 TRAF. SIG.& ST LIGHT MAINT Total 36,874.49 5300 ECON. DEVELOPMENT 65522 NATURE'S PERSPECTIVE LANDSCAPING SEASONAL PLANTING ROTATIONS FOR COMMERCIAL PLANTERS 7,440.00 5300 ECON. DEVELOPMENT Total 7,440.00 100 GENERAL FUND Total 413,590.32 205 EMERGENCY TELEPHONE (E911) FUND 5150 EMERGENCY TELEPHONE SYSTM 65625 WORD SYSTEMS INC DIGITAL VOICE LOGGING SYSTEM UPGRADE 11,179.00 5150 EMERGENCY TELEPHONE SYSTM Total 11,179.00 205 EMERGENCY TELEPHONE (E911) FUND Total 11,179.00 215 CDBG FUND 5170 PUBLIC IMPROVEMENTS 63106 RIDGEVILLE PARK DISTRICT MATERIALS AND LABOR COSTS FOR BRUMMEL PARK RENOVATION 31,443.53 5170 PUBLIC IMPROVEMENTS Total 31,443.53 5187 REHAB CONSTRUCTION ADMIN 62490 EQUIFAX CREDIT HOUSING REHAB ADMIN 11.70 5187 REHAB CONSTRUCTION ADMIN Total 11.70 5220 CDBG ADMINISTRATION 62490 ANCEL,GLINK,DIAMOND,BUSH,DICIANNI & KRAFTHEFER, P.*LEGAL SERVICES: ACQUISITION OF TAX 6,982.47 5220 CDBG ADMINISTRATION Total 6,982.47 215 CDBG FUND Total 38,437.70 220 CDBG LOAN FUND 5280 CD LOAN 65535 PERFECT EDGE, INC HOUSING REHAB - 743 BRUMMEL 31,000.00 5280 CD LOAN Total 31,000.00 220 CDBG LOAN FUND Total 31,000.00 250 AFFORDABLE HOUSING FUND 5465 AFFORDABLE HOUSING 62490 COMMUNITY PARTNERS FOR AFFORDABLE HOUSING CPAH IHO WAITLIST MGMT.10,389.00 5465 AFFORDABLE HOUSING Total 10,389.00 250 AFFORDABLE HOUSING FUND Total 10,389.00 415 CAPITAL IMPROVEMENTS FUND 4116 2016 BOND PROJECTS 616007 62145 CLARK DIETZ, INC.RFP 16-01, FLEETWOOD HVAC & ELEC 6,837.74 616020 62145 TESKA ASSOCIATES, INC.RFP 16-04 GIBBS MORRISON SITE IMPROVEMENTS 2,847.50 415939 65515 IL DEPT OF TRANSPORTATION BRIDGE STREET BRIDGE CONSTRUCTION 22,225.17 4116 2016 BOND PROJECTS Total 31,910.41 4117 2017 GO BOND ISSUANCE 117004 62145 JANET AUSTIN ART ART INSTALLATION AND LEASE AT LAKEFRONT 3,200.00 516004 62145 CHRISTOPHER B. BURKE ENGINEERING, LTD.FOUNTAIN SQUARE RENOVATIONS 21,196.62 417015 62145 CHRISTOPHER B. BURKE ENGINEERING, LTD.STREETLIGHT MASTER PLAN 6,025.76 617023 62145 KPFF, INC., DBA KPFF CONSULTING ENGINEER EMERGENCY SHORING AT SERVICE CENTER 1,344.20 417020 62145 HAMPTON, LENZINI AND RENWICK, INC.BIKE PARKING PROJECT - MAIN STREET CTA ENGINEERING CONTRACT 1,969.50 418001 62145 HAMPTON, LENZINI AND RENWICK, INC.LAND SURVEY ASSISTANCES - 2018 CAPITAL PROJECTS 2,095.83 617043 65515 ABLE DISTRIBUTORS HEAT EXCHANGERS FOR COOLING TOWERS 6,334.95 417017 65515 COOK COUNTY RECORDER OF DEEDS SPECIAL ASSESSMENT RECORDING 1518, 1519, 1520 128.00 415450 65515 IL DEPT OF TRANSPORTATION SHERIDAN RD- CHICAGO AVE PROJECT FUNDING LOCAL SHARE PORTION 963,080.44 417002 65515 CHRISTOPHER B. BURKE ENGINEERING, LTD.HOWARD ST CORRIDOR IMPROVEMENT PROJECT ENGINEERING SRV 52,969.91 415450 65515 CHRISTOPHER B. BURKE ENGINEERING, LTD.SHERIDAN RD-CHICAGO AVE. PHASE III ENG SRVCS 23,359.08 617006 65515 CONSTRUCTION CONSULTING & DISBURSEMENT FLEETWOOD-JOURDAIN WASHROOM RENOVATIONS 10,710.50 4117 2017 GO BOND ISSUANCE Total 1,092,414.79 4118 2018 GO BOND CAPITAL 415450 65515 CHRISTOPHER B. BURKE ENGINEERING, LTD.SHERIDAN RD-CHICAGO AVE. PHASE III ENG SRVCS 53,045.97 4118 2018 GO BOND CAPITAL Total 53,045.97 347 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY2017 4216 2016 CAPITAL FROM OTHER SOURCES 416513 62145 STANLEY CONSULTANTS INC.CENTRAL ST BRIDGE ENGINEERING SRVCS RFQ 16-08 19,891.64 4216 2016 CAPITAL FROM OTHER SOURCES Total 19,891.64 4217 2017 CIP OTHER FUNDING SOURCES 617002 62145 CLARK DIETZ, INC.CHANDLER-NEWBERGER CENTER HVAC&ELECTRICAL IMPROVEMENTS 1,763.85 415450 65515 IL DEPT OF TRANSPORTATION SHERIDAN RD- CHICAGO AVE PROJECT FUNDING LOCAL SHARE PORTION 718,792.64 4217 2017 CIP OTHER FUNDING SOURCES Total 720,556.49 415 CAPITAL IMPROVEMENTS FUND Total 1,917,819.30 505 PARKING SYSTEM FUND 7005 PARKING SYSTEM MGT 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 18.95 7005 PARKING SYSTEM MGT Total 18.95 7015 PARKING LOTS & METERS 62375 CTA/AB LOT RENTAL 990.00 65070 3C PAYMENT (USA) CORP CREDIT AND DEBIT CARD TRANSACTION FEES DECEMBER 2017 995.40 65070 3C PAYMENT (USA) CORP CREDIT AND DEBIT CARD TRANSACTION FEES NOVEMBER 2017 1,278.70 7015 PARKING LOTS & METERS Total 3,264.10 7025 CHURCH STREET GARAGE 64005 DYNEGY UTILITIES-DYNEGY 5,394.09 65050 TYCO SIMPLEX GRINNEL FIRE ALARM TESTING CHURCH STREET GARAGE 1,370.22 7025 CHURCH STREET GARAGE Total 6,764.31 7036 SHERMAN GARAGE 62660 MB EVANSTON SHERMAN, L.L.C.DECEMBER 2017 COMMON AREA MAINTENANCE 7,430.94 64005 DYNEGY UTILITIES-DYNEGY 15,635.14 7036 SHERMAN GARAGE Total 23,066.08 7037 MAPLE GARAGE 64005 DYNEGY UTILITIES-DYNEGY 10,266.50 7037 MAPLE GARAGE Total 10,266.50 505 PARKING SYSTEM FUND Total 43,379.94 510 WATER FUND 4200 WATER PRODUCTION 56140 ILLINOIS DEPT OF REVENUE *SALES TAX- DEC 2017 407.00 62295 MEADE, ELEANORE REIMBURSEMENT: MIDWEST WATER AAW EXPO 44.91 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 37.90 4200 WATER PRODUCTION Total 489.81 4208 WATER BILLING 64540 VERIZON WIRELESS METER LAPTOP'S 114.03 4208 WATER BILLING Total 114.03 4210 PUMPING 64005 COMED UTILITIES COMED 224.78 64005 DYNEGY UTILITIES-DYNEGY 75,098.70 64015 NICOR UTILITIES NICOR 120.62 4210 PUMPING Total 75,444.10 4540 DISTRIBUTION MAINTENANCE 62415 G & L CONTRACTORS, INC 2017 DEBRIS HAULING 1,264.80 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 170.55 65055 TEST GAUGE, INC.HYDRANT METER & BACKFLOW DEVICES 17,051.10 4540 DISTRIBUTION MAINTENANCE Total 18,486.45 510 WATER FUND Total 94,534.39 515 SEWER FUND 4530 SEWER MAINTENANCE 62415 G & L CONTRACTORS, INC 2017 DEBRIS HAULING 2,213.40 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 170.55 65055 G & L CONTRACTORS, INC 2017 GRANULAR MATERIALS 3,501.12 4530 SEWER MAINTENANCE Total 5,885.07 4535 SEWER IMPROVEMENTS 62461 TESKA ASSOCIATES, INC.GIBBS MORRISON SITE IMPROVEMENTS 2,847.50 4535 SEWER IMPROVEMENTS Total 2,847.50 515 SEWER FUND Total 8,732.57 520 SOLID WASTE FUND 4310 RECYCLING AND ENVIRONMENTAL MAIN 56155 ILLINOIS DEPT OF REVENUE *SALES TAX- DEC 2017 14.00 62415 SHRED ALL TRANSFER TIRE RECYCLING 258.05 4310 RECYCLING AND ENVIRONMENTAL MAIN Total 272.05 520 SOLID WASTE FUND Total 272.05 448 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY2017 600 FLEET SERVICES FUND 7705 GENERAL SUPPORT 64540 VERIZON NETWORKFLEET, INC.DECEMBER INVOICE FOR AVL TRACKERS 170.55 7705 GENERAL SUPPORT Total 170.55 7710 MAJOR MAINTENANCE 65045 LISA GRAY REIMBURSEMENT: MP PLATES 120.00 7710 MAJOR MAINTENANCE Total 120.00 600 FLEET SERVICES FUND Total 290.55 605 INSURANCE FUND 7800 RISK MANAGEMENT 62130 JEEP & BLAZER JAMES PARK SERVICES THROUGH 11/30/2017 295,879.54 62130 JEEP & BLAZER JAMES PARK SERVICES THROUGH 12/31/2017 291,406.30 62130 ROBBINS SCHWARTZ NICHOLAS LIFTON & TAYLO SERVICES THROUGH 11/30/2017 11,306.57 7800 RISK MANAGEMENT Total 598,592.41 7801 EMPLOYEE BENEFITS 66040 VARIDESK, LLC SIT STAND DESK PDHQ 2,225.00 7801 EMPLOYEE BENEFITS Total 2,225.00 605 INSURANCE FUND Total 600,817.41 Grand Total 3,170,442.23 549 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2017 ACCOUNT NUMBER SUPPLIER NAME DESCRIPTION AMOUNT SUPPLEMENTAL BILLS LIST ATTACHMENT VARIOUS VARIOUS TWIN EAGLE NATURAL GAS-DECMBER 2017 27,867.43 VARIOUS BANK OF AMERICA PURCHASING CARD 159,115.23 VARIOUS BMO PURCHASING CARD 2,394.26 189,376.92 Grand Total 3,359,819.15 PREPARED BY DATE REVIEWED BY DATE APPROVED BY DATE 650 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 100 GENERAL FUND 100 GENERAL SUPPORT 21639 EYE MED VISION CARE EYE MED MONTHLY INVOICE-FEB 2018 4,125.01 21640 METLIFE SMALL BUSINESS CENTER METLIFE MONTHLY INVOICE-FEB 18 18,016.10 21640 GUARDIAN GUARDIAN DENTAL INVOICE 18,299.39 22785 FRIENDS OF THE ROBERT CROWN CENTER DONATIONS HELD IN ESCROW 15,000.00 41340 COOK COUNTY STATES ATTORNEY VEHICLE SEIZURE #14-22638, 14-32803, 15-19756, 16-31314, 17-1149 764.00 41340 COOK COUNTY STATES ATTORNEY VEHICLE SEIZURE #16-426 525.00 100 GENERAL SUPPORT Total 56,729.50 1300 CITY COUNCIL 62295 NORTHWEST MUNICIPAL CONFERENCE 2018 NWMC LEGISLATIVE BRUNCH 270.00 62360 NATIONAL LEAGUE OF CITIES 2018 MEMBERSHIP DUES 5,952.00 1300 CITY COUNCIL Total 6,222.00 1505 CITY MANAGER 62295 JASON BROWN COLLECTIVE CARTOGRAPHY EQUITY MAPPING WORKSHOP 500.00 62295 SVK INTERCULTURAL LLC ENGAGING WITH DIFFERENCE WORKSHOP 1,000.00 62360 ALLIANCE FOR INNOVATION, INC.MEMBERSHIP RENEWAL 3,980.00 62490 CHICAGO LATIN FITNESS FITNESS CLASS FOR CITY EMPLOYEES 600.00 64540 AT & T MOBILITY *COMMUNICATION CHARGES-JAN 18 129.38 65095 OFFICE DEPOT OFFICE SUPPLIES 245.46 1505 CITY MANAGER Total 6,454.84 1510 PUBLIC INFORMATION 65095 OFFICE DEPOT OFFICE SUPPLIES 13.15 1510 PUBLIC INFORMATION Total 13.15 1555 FINANCIAL ADMINISTRATION 62185 GOV TEMPS USA, LLC TEMPORARY OFFICE STAFF - FINANCE DIVISION 3,990.00 1555 FINANCIAL ADMINISTRATION Total 3,990.00 1560 REVENUE & COLLECTIONS 51600 HAO LI LOT 42 CANCEL - MOVED TO CA 24.00 51620 HELEN WHITMORE KELLY PAID RETT BUT SALE DID NOT OCCUR 1,025.00 52010 ADELLA ZUNAS REFUND: WHEEL TAX 37.50 52010 BROOKE BELCHER REFUND: WHEEL TAX 4.00 52010 XIAOWEI ZHOU REFUND: WHEEL TAX 75.00 52010 FABIAN DELGADO REFUND: WHEEL TAX 75.00 52010 VILMA BELL REFUND: WHEEL TAX 37.50 52010 GEORGIA A COHEN REFUND: WHEEL TAX 38.00 52010 DAVID POLSTER REFUND: WHEEL TAX 300.00 52010 ROSANNE HUGUNIN REVOCABLE TRUST REFUND: WHEEL TAX 37.50 52010 L N LOGAN REFUND: WHEEL TAX 37.50 52010 MARY L QUAID REFUND: WHEEL TAX 37.50 52010 FABIAN CANO REFUND: WHEEL TAX 128.00 52010 SHELLY GRECO REFUND: WHEEL TAX 75.00 52010 RUTH LOVINGOOD REFUND: WHEEL TAX 37.50 52010 COLIN ANOLICK REFUND: WHEEL TAX 37.50 52010 RENETTA SHAPIRO REFUND: WHEEL TAX 37.50 52010 ELLEN AND DONALD ALLEN REFUND: WHEEL TAX 37.50 52010 JANICE CONNER REFUND: WHEEL TAX 37.50 52010 MARILYN GRINAGER-MASON REFUND: WHEEL TAX 37.50 52010 RITA FANG REFUND: SOLD VEHICLE AND NOT REPLACING IT 75.00 52010 LIZ RANSFORD REFUND: WHEEL TAX 75.00 52010 YUKARI LATIMER REFUND: WHEEL TAX SOLD VEHICLE 7571140 75.00 52010 JAMES LAMB REFUND: WHEEL TAX 21.00 52010 KATERINA ALTENBERG REFUND: WHEEL TAX BENEFIT CARD 37.50 52010 PAUL COOPER REFUND: WHEEL TAX BENEFIT CARD 37.50 52010 KENNETH HARRIS REFUND: WHEEL TAX BENEFIT CARD 37.50 52010 LAYA FRISCHER REFUND: WHEEL TAX BENEFIT CARD 37.50 52010 FRANCES BARNETT REFUND: WHEEL TAX BENEFIT CARD 37.50 52010 JUDITH GREENE REFUND: WHEEL TAX 37.50 52010 MEGHA AGGARWAL REFUND: WHEEL TAX 75.00 52010 MARGARET STARKS REFUND: WHEEL TAX 75.00 52010 JOSEPH CERVA REFUND: WHEEL TAX 90.00 52010 NINIB KHANANO REFUND: WHEEL TAX 150.00 52010 RONALD MASTERS REFUND: WHEEL TAX 18.75 52010 CHARLIE AHN REFUND: WHEEL TAX 113.00 52010 JEFFREY SCHULHOFF *REFUND: OVERPAYMENT WHEEL TAX 176.00 52010 WILLIAM BOYD REFUND: WHEEL TAX 37.50 62449 DELL COMPUTER CORP.DELL 24 MONITOR- E2417H AND OPTIPLEX 7050 MT FOR COLLECTORS 11,576.28 62770 TRANSCRIPTION PROFESSIONALS TRANSCRIPTION SERVICES: LEGAL 50.00 64541 AZAVAR AUDIT SOLUTIONS AUDITING RETRO INVOICE 1,934.30 65095 OFFICE DEPOT ANNUAL OFFICE SUPPLY 93.51 65095 OFFICE DEPOT OFFICE SUPPLIES 34.49 1560 REVENUE & COLLECTIONS Total 17,051.33 1575 PURCHASING 65095 OFFICE DEPOT OFFICE SUPPLIES 167.10 1575 PURCHASING Total 167.10 1580 COMMUNITY ARTS 66040 OFFICE DEPOT OFFICE SUPPLIES 15.14 1580 COMMUNITY ARTS Total 15.14 151 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 1705 LEGAL ADMINISTRATION 62315 FEDERAL EXPRESS CORP.SHIPPING 28.75 62509 SUSAN D BRUNNER HEARING OFFICER 2,660.00 62509 JEFFREY D. GREENSPAN HEARING OFFICER 1,470.00 62509 MITCHELL C. EX HEARING OFFICER 1,590.00 1705 LEGAL ADMINISTRATION Total 5,748.75 1929 HUMAN RESOURCE DIVISION 62160 THEODORE POLYGRAPH SERVICE, INC.EMPLOYMENT TESTING-THEODORE POLYGRAPH SERVICES 350.00 62160 THEODORE POLYGRAPH SERVICE, INC.RECRUITMENT-POLICE-THEODORE POLYGRAPH SERVICES 350.00 62270 QUEST DIAGNOSTICS CLINICAL LABORATORIES EMPLOYEE TESTING SERVICES-QUEST DIAGNOSTICS 22.00 62509 TRANS UNION CORP EMPLOYMENT TESTING-TRANS UNION CORP 292.43 62509 ESPYR EAP CONSULTING SERVICES-MONTHLY INVOICE 671.40 1929 HUMAN RESOURCE DIVISION Total 1,685.83 1932 INFORMATION TECHNOLOGY DIVI. 62340 ACCELA, INC.RENEWAL SOFTWARE LICENSING AND PERMIT ACTIVITIES 89,945.28 62380 CHICAGO OFFICE TECHNOLOGY GROUP COPIER CHARGES 156.00 64505 AT & T COMMUNICATION CHARGES 1,114.34 64505 CALL ONE COMMUNICATION CHARGES 8,703.80 64540 VERIZON WIRELESS COMMUNICATION CHARGES 84.24 1932 INFORMATION TECHNOLOGY DIVI. Total 100,003.66 1941 PARKING ENFORCEMENT & TICKETS 52505 CARLOS LOPEZ-ESPINA REFUND: DOUBLE PAID CITATION 700896020 35.00 52505 SARAH KELSEY REFUND: DOUBLE PAID CITATION 700899793 40.00 52505 CAITLYN MURPHY REFUND: DOUBLE PAID CITATION 40.00 62451 NORTH SHORE TOWING IMMOBILIZATION PROGRAM 3,450.00 62451 GENE G. SCOTT TOW REFUND 90.00 62451 CATHLEEN WALKER TOW REFUND 1 DAY STORAGE 45.00 1941 PARKING ENFORCEMENT & TICKETS Total 3,700.00 1950 FACILITIES 62225 ANDERSON PEST CONTROL PEST CONTROL 66.95 62225 COMCAST CABLE CABLE CHARGES 63.08 62225 COMCAST CABLE CABLE CHARGES JAN 2018 109.46 62225 BRANIFF COMMUNICTIONS INC 218 OUTDOOR WARNING SIGNAL PREVENTATIVE MAINTENANCE 2,880.00 62225 CARRIER CORPORATION EMERGENCY CHILLER LEAK REPAIR FIRE 4 1,595.00 62225 RAYES BOILER & WELDING, LTD CIVIC CENTER BOILER MAINTENANCE 1,100.00 62245 ANDREWS TECHNOLOGY HMS, INC.NOVA TIME ATTENDANCE SYSTEM MAINTENANCE 1,615.00 62295 WOPPEL, CHRISTOPHER 2018 ELECTRICAL LICENSE REIMBURSEMENT 200.00 62360 ILL DEPT OF PUBLIC HEALTH APPLICATION FEE: FOUNTAIN SQUARE HEALTH LICENSE 75.00 62440 DOOR SYSTEMS, INC.EMERGENCY REPAIR TO PDHQ OVERHEAD DOORS 2,337.00 62440 RAYNOR DOOR COMPANY EMERGENCY OVERHEAD DOOR REPAIR & PARTS FIRE 2 1,742.77 62440 RAYNOR DOOR COMPANY OVERHEAD DOOR REPAIR FIRE 5 86.40 62509 TYCO INTEGRATED SECURITY LLC CHURCH STREET GARAGE ALARM SERVICE 212.00 64005 COMED UTILITY COMED 70.22 64015 NICOR UTILITIES NICOR 1,644.60 65050 MARK VEND COMPANY COFFEE AND SUPPLIES 336.00 1950 FACILITIES Total 14,133.48 2126 BUILDING INSPECTION SERVICES 52080 DANLEY'S GARAGE WORLD REFUND PERMIT: 17ACCS-0040 554.95 62645 MICROSYSTEMS INC.CD DIGITAL ARCHIVING 938.37 2126 BUILDING INSPECTION SERVICES Total 1,493.32 2205 POLICE ADMINISTRATION 62210 MSF GRAPHICS, INC.PRINTING SERVICES - DAILY ACTIVITY 336.00 62210 THE PRINTED WORD, INC.BUSINESS CARDS 180.00 62280 FEDERAL EXPRESS CORP.OVERNIGHT SHIPPING 16.13 62360 EDDINGTON, RICHARD REIMBURSEMENT ANNUAL MEMBERSHIP - NORTH SUB CHIEFS 75.00 62360 MID-STATES ORGANIZED CRIME INFORMATION CENTER ANNUAL MEMBERSHIP 300.00 62490 NATIONAL AWARDS & FINE GIFTS RETIREMENT PLAQUE & NAMEPLATE 70.00 64015 NICOR UTILITIES NICOR 404.54 64540 VERIZON WIRELESS COMMUNICATION CHARGES 152.04 65095 ILLINOIS PAPER DBA IMPACT NETWORKING LLC PAPER SUPPLIES 1,404.00 2205 POLICE ADMINISTRATION Total 2,937.71 2210 PATROL OPERATIONS 62240 EVANSTON CAR WASH & DETAIL CENTER CAR WASHES 320.00 62490 EVANSTON FUNERAL & CREMATION BODY REMOVAL 1,300.00 62490 LAUNDRY WORLD LAUNDRY SERVICE - PRISONER BLANKETS 196.00 65020 ABAH ANTONIO ACADEMY UNIFORM REIMBURSEMENT 130.34 65020 VCG UNIFORM UNIFORM - NEW RECRUIT 2,267.69 65125 ULINE RANGE - EARPLUGS 56.53 2210 PATROL OPERATIONS Total 4,270.56 2225 SOCIAL SERVICES BUREAU 62370 CITY OF EVANSTON - PETTY CASH PETTY CASH - YOUTH SERVICES 161.31 2225 SOCIAL SERVICES BUREAU Total 161.31 2240 POLICE RECORDS 62645 MICROSYSTEMS INC.DIGITAL ARCHIVING - ANNUAL SUBSCRIPTION 473.47 2240 POLICE RECORDS Total 473.47 252 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 2251 311 CENTER 64505 AT & T *COMMUNICATION CHARGES- 311 SERVICE 402.36 2251 311 CENTER Total 402.36 2260 OFFICE OF ADMINISTRATION 62295 KLEINPASTE, JASON MEALS/TRAINING - 40 HR GANG SPECIALIST 75.00 62295 KLEINPASTE, JASON MEALS/TRAVEL - INTERVIEW 50.00 62295 COOK COUNTY SHERIFF'S TRAINING INST.TRAINING - NEW RECRUIT 3,250.00 62295 CITY OF EVANSTON PETTY CASH PETTY CASH - ADMINISTRATION 404.27 62295 NORTH EAST MULTI-REGIONAL TRAINING INC TRAINING - DRUG & INTELLIGENCE GATHERING 150.00 62295 TRITON COMMUNITY COLLEGE TRAINING - NEW RECRUIT TECH FEE 300.00 62295 VELEZ, LUIS MEALS/TRAINING - 40 HR GANG SPECIALIST 75.00 62295 HUNT, WILLIE J MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 DUKLER, MARLA MEALS/TRAVEL - INTERVIEW 50.00 62295 CURTIN, THOMAS MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 SCOTT SOPHIER MEALS/TRAINING - INSTRUCTOR DEVELOPMENT 75.00 62295 HEIDI BERNHARDT MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 CORRIE SVENDSON MEALS/TRAVEL - INTERVIEW 105.58 62295 TOSHA WILSON MEALS/TRAVEL - INTERVIEW 50.00 62295 DAVID CEPIEL MEALS/TRAINING - GROWING ADAPTIVE THINKING 45.00 62295 POLICE LAW INSTITUTE POLICE TRAINING PLATFORM 11,137.50 62295 CARL GUSTAFSON MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 KYLE HARVEY MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 MATTHEW MASSUCI MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 WILLIAM ARZUAGA MEALS/TRAINING - INSTRUCTOR DEVELOPMENT 75.00 62295 ADAM NAWOTKA MEALS/TRAINING -40 HR LEAD HOMICIDE INVEST.75.00 62295 ERIC HUBER MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 62295 EWA BONISLAWSKI MEALS/TRAINING - CRISIS INTERVENTION TEAM 75.00 65095 OFFICE DEPOT OFFICE SUPPLIES - POLICE ADMIN 888.81 2260 OFFICE OF ADMINISTRATION Total 17,406.16 2270 TRAFFIC BUREAU 62490 NORTH SHORE TOWING TOW & HOOK 50.00 62490 NORTH SHORE TOWING TOW & HOOK (DISREGARD)10.00 65120 HAVEY COMMUNICATIONS INC.TRAFFIC UNIT MOTORCYCLE SAFETY LIGHTS 2,154.10 2270 TRAFFIC BUREAU Total 2,214.10 2280 ANIMAL CONTROL 52020 SALLY KRAKAU OVERPAID PET LICENSE 5.00 62225 ANDERSON PEST CONTROL PEST CONTROL - ANIMAL SHELTER 58.14 2280 ANIMAL CONTROL Total 63.14 2291 PROPERTY BUREAU 65125 B&H PHOTO VIDEO EVIDENCE SUPPLIES 760.15 65125 DOJE'S FORENSIC SUPPLIES FORENSICS SUPPLIES 1,545.80 65125 JACKSON-HIRSCH, INC.PROPERTY SUPPLIES 162.06 65125 LYNN PEAVEY COMPANY EVIDENCE SUPPLIES 718.02 65125 ECPI/ARROWHEAD FORENSIC PRODUCTS FORENSICS SUPPLIES 586.05 65125 HOUSE OF CANS INC PROPERTY SUPPLIES 106.38 65125 ULINE PROPERTY SUPPLIES 951.15 65125 PORTER LEE CORPORATION PROPERTY SUPPLIES 554.48 2291 PROPERTY BUREAU Total 5,384.09 2295 BUILDING MANAGEMENT 65125 DUSTCATCHERS, INC.FLOOR MATS 140.25 2295 BUILDING MANAGEMENT Total 140.25 2305 FIRE MGT & SUPPORT 62315 FEDERAL EXPRESS CORP.SHIPPING 27.46 64015 NICOR UTILITIES NICOR 1,708.61 64540 VERIZON WIRELESS COMMUNICATION CHARGES 38.01 65020 AIR ONE EQUIPMENT STRUCTURAL BOOTS 305.00 65020 AIR ONE EQUIPMENT TURNOUT GEAR REPAIR 840.25 65020 TODAY'S UNIFORMS INC.UNIFORMS 4,511.03 65050 HASTINGS AIR-ENERGY CONTROL EXHAUST REPAIRS 53.43 2305 FIRE MGT & SUPPORT Total 7,483.79 2310 FIRE PREVENTION 62295 ILLINOIS FIRE INSPECTORS ASSOCIATION SEMINAR 50.00 2310 FIRE PREVENTION Total 50.00 2315 FIRE SUPPRESSION 53715 RACHEL ANGULO REFUND: ALARM REGISTRATION 110.00 62295 TARGET SOLUTIONS, INC SOFTWARE FEE 9,918.00 62295 LEADERSHIP UNDER FIRE, INC.OFFICER TRAINING 3,750.00 62521 PHYSIO-CONTROL, INC.CARDIAC MONITOR SERVICE 12,589.44 62605 MABAS DIVISION III ANNUAL MABAS DUES 5,000.00 65015 PRAXAIR DISTIBUTION INC MEDICAL OXYGEN 606.97 65085 AIR ONE EQUIPMENT REPAIR PARTS 37.79 65125 GRAINGER, INC., W.W.CFL BULBS 46.50 65625 WORLDPOINT ECC, INC.CPR 16.15 2315 FIRE SUPPRESSION Total 32,074.85 2407 HEALTH SERVICES ADMIN 62295 EVONDA THOMAS-SMITH REIMBURSEMENT :TOBACCO 21 PRESS CONFERENCE 219.49 2407 HEALTH SERVICES ADMIN Total 219.49 353 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 2435 FOOD AND ENVIRONMENTAL HEALTH 61055 GOV TEMPS USA, LLC TEMP HEALTH STAFF 1,039.50 61055 GOV TEMPS USA, LLC TEMPORARY STAFF HEALTH 1/21/18 831.60 61055 GOV TEMPS USA, LLC TEMPORARY STAFF HEALTH/14/2018 1,372.70 62493 ECO GREENERGY PROPERTIES, LLC GARAGE DEPRIS REMOVAL 1413 FLORENCE AVE 900.00 62605 ROSE PEST SOLUTIONS PEST CONTROL 6,240.00 65075 FINEST COURIER LOGISTICS COURIER SERVICES 70.00 2435 FOOD AND ENVIRONMENTAL HEALTH Total 10,453.80 2440 VITAL RECORDS 62210 MSF GRAPHICS, INC.BIRTH CERTIFICATES 1,152.00 2440 VITAL RECORDS Total 1,152.00 3010 REC. BUSINESS & FISCAL MGMT 65095 OFFICE DEPOT OFFICE SUPPLIES 237.00 3010 REC. BUSINESS & FISCAL MGMT Total 237.00 3020 REC GENERAL SUPPORT 62375 SERVICE SANITATION INC PORTABLE TOILET 320.00 3020 REC GENERAL SUPPORT Total 320.00 3025 PARK UTILITIES 64005 COMED UTILITY COMED 44.69 64015 NICOR UTILITIES NICOR 86.42 3025 PARK UTILITIES Total 131.11 3030 CROWN COMMUNITY CENTER 62505 GARY KANTOR MAGIC CLASS INSTRUCTOR 294.00 64015 NICOR UTILITIES NICOR 151.97 65040 UNIFIRST CORPORATION JANITORIAL SUPPLY 22.32 65040 UNIFIRST CORPORATION MAT CLEANING 22.32 3030 CROWN COMMUNITY CENTER Total 490.61 3035 CHANDLER COMMUNITY CENTER 62495 ANDERSON PEST CONTROL MONTHLY PEST CONTROL 34.32 64015 NICOR UTILITIES NICOR 296.51 65095 ILLINOIS PAPER DBA IMPACT NETWORKING LLC WHITE COPY PAPER 89.10 3035 CHANDLER COMMUNITY CENTER Total 419.93 3040 FLEETWOOD JOURDAIN COM CT 62225 SUPERIOR INDUSTRIAL SUPPLY TRASH CAN LINER 22.28 62495 ANDERSON PEST CONTROL MONTHLY SERVICE FOR PEST CONTROL 76.56 62505 BRIEVA, ELIZABETH VOLLEYBALL COACH FOR SKILLS AND DRILLS CLINIC.300.00 62511 COMCAST CABLE COMMUNICATION CHARGES- JAN 18 100.63 62511 COREY BLESS PRODUCTION, LLC DJ FOR FATHER DAUGHTER DANCE 250.00 64015 NICOR UTILITIES NICOR 419.69 65025 SMIGO MANAGEMENT GROUP DBA HOFFMAN HOUSE CATERING SENIORS LUNCHES CATERING FOR WEDNESDAYS 795.50 3040 FLEETWOOD JOURDAIN COM CT Total 1,964.66 3045 FLEETWOOD/JOURDAIN THEATR 62505 DELONG, ANTORA LEAD INSTRUCTOR TATER TOT PROGRAM 350.00 62505 DEJAH LAMARIA DYER ASSISTANT INSTRUCTOR TATER TOT PROGRAM 110.00 62505 SERENA DULLY BLACK HISTORY MONTH STAGE MANAGER 300.00 62505 JONATHAN WILSON BLACK HISTORY MONTH DIRECTOR 500.00 62511 MIXON, DONOVAN BLACK HISTORY MONTH MUSICIAN AND DIRECTOR 300.00 62511 REGINALD THOMAS BLACK HISTORY MONTH MUSICIAN AND ONE SINGER 200.00 62511 DIONNE ADDAI BLACK HISTORY MONTH PERFORMER 300.00 62511 ROSENBERG, MARLENE BLACK HISTORY MONTH MUSICIAN EVENT 100.00 3045 FLEETWOOD/JOURDAIN THEATR Total 2,160.00 3050 RECREATION OUTREACH PROGRAM 65125 ILLINOIS STATE BOARD OF EDUCATION REPAYMENT FOR STATE OVERPAYMENT 2,754.02 3050 RECREATION OUTREACH PROGRAM Total 2,754.02 3055 LEVY CENTER SENIOR SERVICES 62210 ALLEGRA PRINT & IMAGING LEVY NEWSLETTER 629.00 62245 DIRECT FITNESS SOLUTIONS FITNESS EQUIPMENT REPAIRS 115.00 62505 RICHMOND, PHYLLIS INSTRUCTOR ALEXANDER TECHNIQUE 200.00 62509 CINTAS CORPORATION #769 MONTHLY MAT SERVICE 257.98 64015 NICOR UTILITIES NICOR 427.63 65040 SUPERIOR INDUSTRIAL SUPPLY JANITORIAL SUPPLIES - LEVY 592.70 65095 ILLINOIS PAPER DBA IMPACT NETWORKING LLC PAPER - LEVY 157.60 3055 LEVY CENTER SENIOR SERVICES Total 2,379.91 3095 CROWN ICE RINK 62245 JORSON & CARLSON ICE SCRAPER KNIVES CLEANED 37.67 62245 JORSON & CARLSON ICE SCRAPER MAINTENANCE 37.67 62251 TOTAL MECHANICAL SOLUTIONS, LLC COMPRESSOR MAINTENANCE 430.00 62360 SESAC MUSIC LICENSING 1,357.00 62490 GRAINGER, INC., W.W.LIGHT BULBS 90.60 62495 ANDERSON PEST CONTROL PEST MANAGEMENT 81.37 64015 NICOR UTILITIES NICOR 455.90 65040 SUPERIOR INDUSTRIAL SUPPLY ICE DISSOLVER 43.64 65040 SUPERIOR INDUSTRIAL SUPPLY JANITORIAL SUPPLY 481.23 65040 UNIFIRST CORPORATION JANITORIAL SUPPLY 66.94 65040 UNIFIRST CORPORATION MAT CLEANING 66.94 3095 CROWN ICE RINK Total 3,148.96 454 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 3225 GIBBS-MORRISON CULTURAL CENTER 62509 MOTHER-DAUGHTER TRIBAL:ATS BELLY DANCE CLASS INSTRUCTOR 64.80 62509 CINTAS CORPORATION #769 MONTHLY MAT SERVICE 94.72 65040 SUPERIOR INDUSTRIAL SUPPLY JANITORIAL SUPPLIES 298.20 3225 GIBBS-MORRISON CULTURAL CENTER Total 457.72 3605 ECOLOGY CENTER 62511 WINGS AND TALONS RAPTOR PROGRAM 200.00 64015 NICOR UTILITIES NICOR 354.98 65040 SUPERIOR INDUSTRIAL SUPPLY JANITORIAL SUPPLIES - ECOLOGY 73.14 3605 ECOLOGY CENTER Total 628.12 3710 NOYES CULTURAL ARTS CENTER 62518 ALARM DETECTION SYSTEMS, INC.QUARTERLY ALARM CHARGES 286.50 64015 NICOR UTILITIES NICOR 523.44 65040 SUPERIOR INDUSTRIAL SUPPLY JANITORIAL SUPPLIES 285.95 3710 NOYES CULTURAL ARTS CENTER Total 1,095.89 3720 CULTURAL ARTS PROGRAMS 62505 ALLIE BARON ASSISTANT DIRECTOR ECT 875.00 62505 DONALD KOLAKOWSKI DIRECTOR EVANSTON CHILDREN'S THEATRE SPRING SHOW 1,125.00 62505 HANNAH WERNER PREP AND TEACH MOM AND TOTS CLASSES 750.00 62509 DAYNA CALDERON FIRST HALF PAYMENT STARLIGHT CONCERT 1,012.50 3720 CULTURAL ARTS PROGRAMS Total 3,762.50 3806 CIVIC CENTER SERVICES 64015 NICOR UTILITIES NICOR 1,021.27 3806 CIVIC CENTER SERVICES Total 1,021.27 4105 PUBLIC WORKS AGENCY ADMIN 52130 GANG LIU REFUND: RESIDENTIAL PERMIT 7.50 52130 JASON ALLEN REFUND: RESIDENTIAL PERMIT 15.00 52130 SARAH LLOYD REFUND: RESIDENTIAL PERMIT 15.00 52130 JAMES DURAN REFUND: RESIDENTIAL PERMIT 32.00 52130 MADELINE KAUFMAN REFUND: RESIDENTIAL PERMIT 30.00 52130 CLAUDIA HENTSCHEL REFUND: RESIDENTIAL PERMIT 45.00 52130 MICHAEL THOMPSON REFUND: RESIDENTIAL PERMIT 19.00 52130 RHANDA SALAMEH REFUND: RESIDENTIAL PERMIT 15.00 52130 KABERI BANERJEE REFUND: RESIDENTIAL PERMIT 37.50 52130 KATHY HAYES REFUND: RESIDENTIAL PERMIT 4.00 52130 THOMAS CRAMER REFUND: RESIDENTIAL PERMIT 25.00 52130 DEDRE GENTNER REFUND: RESIDENTIAL PERMIT 16.00 52130 SIAMAK MOSTOUFI REFUND: RESIDENTIAL PERMIT 30.00 52130 JEFFREY MERRELL REFUND: RESIDENTIAL PERMIT 15.00 52130 DOUGLAS MEDIN REFUND: RESIDENTIAL PERMIT 30.00 52130 JOAN KYSER REFUND: RESIDENTIAL PERMIT 15.00 52130 WILLIAM QUAM REFUND: RESIDENTIAL PERMIT 15.00 52130 ALEXANDER KINTNER REFUND: RESIDENTIAL PERMIT 15.00 52130 MARK MARANTO REFUND: RESIDENTIAL PERMIT 15.00 52130 RITA FANG REFUND: RESIDENTIAL PERMIT 15.00 52131 TONISE PAUL REFUND: VISITOR PASSES 4.00 52131 LOWELL SACHNOFF REFUND: FOR VP - NOT ELIGIBLE 4.00 52131 BEATRICE DONOVAN REFUND: FOR VP - NOT ELIGIBLE 2.00 52131 ALLYSON TOPIN REFUND: FOR VP - NOT ELIGIBLE 2.00 65090 CINTAS FIRST AID & SUPPLY FIRST AID CABINET 39.75 4105 PUBLIC WORKS AGENCY ADMIN Total 462.75 4320 FORESTRY 62385 NELS J. JOHNSON TREE EXPERTS, INC.REMOVAL OF FOUR ELM TREES 2,485.00 4320 FORESTRY Total 2,485.00 4400 CAPITAL PLANNING & ENGINEERING 65095 OFFICE DEPOT OFFICE SUPPLIES 119.73 4400 CAPITAL PLANNING & ENGINEERING Total 119.73 4510 STREET MAINTENANCE 65055 OZINGA CHICAGO RMC, INC.CONCRETE PURCHASE 1,305.00 4510 STREET MAINTENANCE Total 1,305.00 4520 TRAF. SIG.& ST LIGHT MAINT 65115 MIDWEST FENCE COMPANY GUARD RAIL REPAIRS 1,160.20 4520 TRAF. SIG.& ST LIGHT MAINT Total 1,160.20 4550 MAINT-SNOW & ICE 65015 MORTON SALT 2018 BULK ROCK SALT PURCHASE 46,323.45 4550 MAINT-SNOW & ICE Total 46,323.45 100 GENERAL FUND Total 375,123.01 205 EMERGENCY TELEPHONE (E911) FUND 5150 EMERGENCY TELEPHONE SYSTM 62295 CHRISTOPHER VOSS MEALS/TRAINING - COMMUNICATIONS CENTER SUPERV.45.00 62509 PATTEN INDUSTRIES DIESEL GENERATOR MAINTENANCE 807.00 64540 VERIZON WIRELESS COMMUNICATION CHARGES 2,188.87 5150 EMERGENCY TELEPHONE SYSTM Total 3,040.87 205 EMERGENCY TELEPHONE (E911) FUND Total 3,040.87 555 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 215 CDBG FUND 5220 CDBG ADMINISTRATION 62285 FEDERAL EXPRESS CORP.SHIPPING 20.63 5220 CDBG ADMINISTRATION Total 20.63 215 CDBG FUND Total 20.63 220 CDBG LOAN FUND 5280 CD LOAN 65535 PRIORITY MANAGEMENT SERVICES, LLC HOUSING REHAB - 1941 HARTREY 11,340.00 5280 CD LOAN Total 11,340.00 220 CDBG LOAN FUND Total 11,340.00 415 CAPITAL IMPROVEMENTS FUND 4116 2016 BOND PROJECTS 616007 65515 CENTRAL LAKES CONSTRUCTION CO. INC.FLEETWOOD JOURDAIN CENTER HVAC & ELECTRICAL IMPRVS 128,955.00 4116 2016 BOND PROJECTS Total 128,955.00 4117 2017 GO BOND ISSUANCE 616017 62145 WOODHOUSE TINUCCI ARCHITECTS ROBERT CROWN 146,798.85 617042 65515 CDW GOVERNMENT INC.UNINTERRUPTIBLE POWER SUPPLY CITY DATA CENTER 19,977.65 616007 65515 CENTRAL LAKES CONSTRUCTION CO. INC.FLEETWOOD JOURDAIN CENTER HVAC & ELECTRICAL IMPRVS 74,636.00 65515 MARIO TRETO JR *REIMBURSEMENT: RECORDING FEES 290.00 4117 2017 GO BOND ISSUANCE Total 241,702.50 4118 2018 GO BOND CAPITAL 616017 62145 COMED *ELECTRIC SERVICES: LABOR FOR 1655 FOSTER 8,769.64 616017 62145 COMED *ELECTRIC SERVICES: ROBERT CROWN 3,000.00 117004 62145 JANET AUSTIN ART ART LEASE AT LAKEFRONT 2,000.00 4118 2018 GO BOND CAPITAL Total 13,769.64 4217 2017 CIP OTHER FUNDING SOURCES 516004 65515 COPENHAVER CONSTRUCTION FOUNTAIN SQUARE RENOVATIONS 252,382.77 4217 2017 CIP OTHER FUNDING SOURCES Total 252,382.77 415 CAPITAL IMPROVEMENTS FUND Total 636,809.91 505 PARKING SYSTEM FUND 7005 PARKING SYSTEM MGT 53460 HAO LI LOT 42 CANCEL - MOVED TO CA 76.00 7005 PARKING SYSTEM MGT Total 76.00 7025 CHURCH STREET GARAGE 64505 CALL ONE COMMUNICATION CHARGES 419.86 7025 CHURCH STREET GARAGE Total 419.86 7036 SHERMAN GARAGE 64505 CALL ONE COMMUNICATION CHARGES 503.17 7036 SHERMAN GARAGE Total 503.17 7037 MAPLE GARAGE 64505 CALL ONE COMMUNICATION CHARGES 990.44 7037 MAPLE GARAGE Total 990.44 505 PARKING SYSTEM FUND Total 1,989.47 510 WATER FUND 4200 WATER PRODUCTION 53575 SUSAN BLATZ *REFUND: OVERPAYMENT WATER 25.00 62210 ALLEGRA PRINT & IMAGING WTP-TISDAHL WINDOW DECAL 75.00 64505 CALL ONE COMMUNICATION CHARGES 261.37 4200 WATER PRODUCTION Total 361.37 4210 PUMPING 64015 NICOR UTILITIES NICOR 1,353.08 4210 PUMPING Total 1,353.08 4220 FILTRATION 62465 EUROFINS EATON ANALYTICAL FY 2018 LABORATORY TESTING-ROUTINE COMPLIANCE 750.00 65015 ALEXANDER CHEMICAL CORPORATION HYDROFLUOROSILICIC ACID (PER SPEC)6,909.76 65015 ALEXANDER CHEMICAL CORPORATION LIQUID CHLORINE (PER SPEC)2,672.00 65030 CARUS PHOSPHATES, INC.ORTH POLYPHOSPHATE (PER SPEC)16,250.40 4220 FILTRATION Total 26,582.16 4225 WATER OTHER OPERATIONS 62185 KARRA BARNES CMMS SPECIALIST CONTRACT SALARY 2018 7,500.00 62315 SEBIS DIRECT UTILITY BILL PRINT & MAIL SERVICES 2,500.00 4225 WATER OTHER OPERATIONS Total 10,000.00 510 WATER FUND Total 38,296.61 656 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 515 SEWER FUND 4530 SEWER MAINTENANCE 62315 SEBIS DIRECT UTILITY BILL PRINT & MAIL SERVICES 2,500.00 4530 SEWER MAINTENANCE Total 2,500.00 515 SEWER FUND Total 2,500.00 520 SOLID WASTE FUND 4310 RECYCLING AND ENVIRONMENTAL MAIN 62405 SOLID WASTE AGENCY NORTHERN COOK FY2018 SWANCC DISPOSAL FEES 106,956.88 62415 ULINE GAYLORD FOR COLLECTIVE RESOURCES - PLASTIC FILM COLLECTION 1,086.68 64015 NICOR UTILITIES NICOR 329.56 4310 RECYCLING AND ENVIRONMENTAL MAIN Total 108,373.12 520 SOLID WASTE FUND Total 108,373.12 600 FLEET SERVICES FUND 7705 GENERAL SUPPORT 64505 CALL ONE COMMUNICATION CHARGES 737.96 65095 OFFICE DEPOT OFFICE SUPPLIES 59.39 7705 GENERAL SUPPORT Total 797.35 7710 MAJOR MAINTENANCE 62240 RACK'M UP DISTRIBUTORS, INC.REPAIRS TO OMAR LIFT ROLLING JACKS 2,650.00 62355 CINTAS #22 WEEKLY UNIFORM SERVICE 488.67 62355 CINTAS CORPORATION #769 WEEKLY MAT SERVICE 528.40 65035 ACCURATE TANK TECHNOLOGIES FUEL PUMP #3 & #7 HOSES WERE LEAKING 1,365.74 65060 1ST AYD CORPORATION CHEMICALS FOR THE SHOP 1,237.55 65060 ATLAS BOBCAT, INC.BROOM STANDS 288.35 65060 ATLAS BOBCAT, INC.REPAIRS TO TOOLCAT #640...ESTIMATE#TC813 3,218.82 65060 ATLAS BOBCAT, INC.RUBBER EDGE 696.37 65060 BUCK BROTHERS, INC.BEARING #603 105.56 65060 BUCK BROTHERS, INC.PARTS CATALOG 38.73 65060 EVANSTON CAR WASH & DETAIL CENTER 5 CAR WASHES 40.00 65060 GROVER WELDING COMPANY #630 REPLACE BROKEN PISTON 140.00 65060 GROVER WELDING COMPANY FABRICATE NEW LID FOR #630 ASPHALT TRAILER 2,323.50 65060 HAVEY COMMUNICATIONS INC.AUX POWER RECEIPT 82.80 65060 HAVEY COMMUNICATIONS INC.VIDEO CONSOLES IN POLICE CARS 779.75 65060 INTERSTATE BATTERY OF NORTHERN CHICAGO BATTERIES 1,666.84 65060 LEACH ENTERPRISES, INC.DESICCANT FILTER 131.03 65060 LEACH ENTERPRISES, INC.HUB CAP 135.51 65060 LEACH ENTERPRISES, INC.PETCOCK 136.30 65060 LEACH ENTERPRISES, INC.WIPER BLADE 300.40 65060 MONROE TRUCK EQUIPMENT DEFLECTORS 855.60 65060 MONROE TRUCK EQUIPMENT LIFT ARM 175.57 65060 NORTH SHORE TOWING TIRE CHANGE 50.00 65060 NORTH SHORE TOWING TOW 920 TO RUSH TRUCK 525.00 65060 RACK'M UP DISTRIBUTORS, INC.SERVICE CALL ON OMAR LIFT 247.50 65060 INTERSTATE POWER SYSTEMS, INC.TENSIONER 338.08 65060 P & G KEENE ELECTRICAL JOHN DEERE STARTER 245.00 65060 GLOBAL EMERGENCY PRODUCTS, INC.EFD #323 ANNUAL PUMP TEST 1,910.50 65060 GLOBAL EMERGENCY PRODUCTS, INC.RADIATOR CAP 15.17 65060 FASTENAL COMPANY PLOW BOLTS 292.00 65060 FASTENAL COMPANY PLOW WASHERS 81.00 65060 FOSTER COACH SALES, INC.VENT FAN 40.88 65060 ADVANCE AUTO PARTS BRAKE HOSE & LINES 70.76 65060 ADVANCE AUTO PARTS HOSE CLIPS 3.26 65060 HOWARD AUTO SERVICE 92 SAFETY LANE TESTS FOR COE TRUCKS 2,116.00 65060 GOLF MILL FORD #13 SEAT BELT BUCKLE 102.28 65060 GOLF MILL FORD #16 WINDOW REGULATOR 325.56 65060 GOLF MILL FORD #253 LOCK CYL 55.58 65060 GOLF MILL FORD #314 BRAKE CALIPERS 581.06 65060 GOLF MILL FORD #43 TURN SIGNAL MODULE 252.23 65060 GOLF MILL FORD #541 ALTERNATOR 140.06 65060 GOLF MILL FORD #541 FUEL INJECTOR 687.40 65060 GOLF MILL FORD #541 IPR VALVE 220.25 65060 GOLF MILL FORD #571 EGR VALVE, COOLER 805.57 65060 GOLF MILL FORD #621 SENSOR 67.65 65060 GOLF MILL FORD #733 REPAIRS 288.00 65060 GOLF MILL FORD #914 HUB ASSY 1,437.04 65060 GOLF MILL FORD AXLE FLANGE GASKETS 9.42 65060 GOLF MILL FORD AXLE SEALS 105.44 65060 GOLF MILL FORD BRAKE CALIPER 581.06 65060 GOLF MILL FORD COOLANT HOSE 60.44 65060 GOLF MILL FORD CREDIT -1,147.01 65060 GOLF MILL FORD EGR VALVES, COOLERS SENSORS 1,611.14 65060 GOLF MILL FORD MAP SENSOR 101.64 65060 GOLF MILL FORD WINDSHIELD WASHER NOZZLES 55.30 65060 ORLANDO AUTO TOP 323 INSTALL DOOR GLASS 300.00 65060 ORLANDO AUTO TOP 43 SEAT REPAIR 120.00 65060 LAWSON PRODUCTS, INC.CREDIT -37.00 65060 LAWSON PRODUCTS, INC.FLAT WASHERS 37.00 65060 LAWSON PRODUCTS, INC.LOCK NUTS 13.62 65060 LAWSON PRODUCTS, INC.WASHERS 40.00 757 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 65060 CHICAGO PARTS & SOUND, LLC FAN & MOTOR 76.27 65060 CHICAGO PARTS & SOUND, LLC IGNITION COIL 89.39 65060 ADVANCED PROCLEAN INC.EQUIPMENT POWER WASHING 943.80 65060 MID-TOWN PETROLEUM ACQUISITION LLC DBA:DEF 306.08 65060 MID-TOWN PETROLEUM ACQUISITION LLC DBA:SYN OIL IN DRUM 115.70 65060 APC STORES, INC., DBA BUMPER TO BUMPER BELTS 240.16 65060 APC STORES, INC., DBA BUMPER TO BUMPER BRAKE HOSE 24.50 65060 APC STORES, INC., DBA BUMPER TO BUMPER EXPERT PLUS 2018 120.00 65060 APC STORES, INC., DBA BUMPER TO BUMPER FILTERS 121.26 65060 APC STORES, INC., DBA BUMPER TO BUMPER HYDRAULIC FITTING 298.68 65060 APC STORES, INC., DBA BUMPER TO BUMPER OIL FILTER 13.56 65060 APC STORES, INC., DBA BUMPER TO BUMPER PRIMARY WIRE - 100' WHITE 29.00 65060 APC STORES, INC., DBA BUMPER TO BUMPER RELAY 13.19 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC #451 FUEL FILTER HOUSING 410.00 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC AIR FILTER 283.60 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC AY-ASA 194.70 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC BREATHER KIT 58.20 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC COMBINATION 576.30 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC COOLANT CAP ASSY 263.46 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC CREDIT -210.69 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC CREDIT FUEL INJECTOR CORES -1,596.00 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC DOOR SWITCH 213.06 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC DOOR TRIM FASTENERS 164.20 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC DUST SHIELD 131.70 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC FILTERS 276.50 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC FITTINGS 27.66 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC FUEL OUTLET 43.59 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC GASKET 127.60 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC GLASS CHANNEL #316 170.30 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC HARNESS 55.90 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC HARNESS #923 1,379.43 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC HORN KIT 185.00 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC HORN KITS 185.00 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC PRIMER PUMP 110.16 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC SWITCH 28.21 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC TEMP SENSORS 229.50 65060 RUSH TRUCK CENTERS OF ILLINOIS, INC THERMOSTATS 79.80 65085 GOLF MILL FORD TOOL 206.14 7710 MAJOR MAINTENANCE Total 36,119.28 600 FLEET SERVICES FUND Total 36,916.63 601 EQUIPMENT REPLACEMENT FUND 7780 VEHICLE REPLACEMENTS 62402 NISSAN MOTOR ACCEPTANCE JANUARY LEASE PAYMENT 3 VEHICLES 927.44 65550 CURRIE MOTORS PURCHASE OF 2 REPLACEMENT VEHICLES #170 AND #932 112,863.00 7780 VEHICLE REPLACEMENTS Total 113,790.44 601 EQUIPMENT REPLACEMENT FUND Total 113,790.44 605 INSURANCE FUND 7801 EMPLOYEE BENEFITS 66054 SENIORS CHOICE SENIORS CHOICE INVOICE 1,661.36 7801 EMPLOYEE BENEFITS Total 1,661.36 605 INSURANCE FUND Total 1,661.36 Grand Total 1,329,862.05 858 of 549 CITY OF EVANSTON BILLS LIST PERIOD ENDING 02.13.2018 FY 2018 ACCOUNT NUMBER SUPPLIER NAME DESCRIPTION AMOUNT SUPPLEMENTAL BILLS LIST ATTACHMENT GENERAL VARIOUS VARIOUS RECTRAC REFUNDS 97.50 97.50 INSURANCE VARIOUS IPBC MONTHLY CORPORATIVE CONTRIBUTION 1,257,076.81 VARIOUS VARIOUS WORKERS COMP 22,564.19 VARIOUS VARIOUS CASUALTY LOSS 31.05 VARIOUS VARIOUS WORKERS COMP 2,481.82 VARIOUS VARIOUS WORKERS COMP 16,319.43 1,298,473.30 SEWER 7565.68305 IEPA LOAN DISBURSEMENT SEWER FUND 180,453.35 7565.68305 IEPA LOAN DISBURSEMENT SEWER FUND 164,784.38 345,237.73 1,643,808.53 Grand Total 2,973,670.58 PREPARED BY DATE REVIEWED BY DATE APPROVED BY DATE 959 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTION311 CENTERSNAPENGAGE CHAT49.00$ 12/15/2017 64505 TELECOMMUNICATIONS CARRIER LINE CH 311 MONTHLY LIVE CHAT311 CENTERJEWEL #342875.98$ 12/21/2017 64505 TELECOMMUNICATIONS CARRIER LINE CH 311 HOLIDAY LUNCH311 CENTERWPY ONEREACH198.00$ 12/26/2017 64505 TELECOMMUNICATIONS CARRIER LINE CH 311 MONTHLY LIVE TEXT311 CENTERINTERNATION200.00$ 12/28/2017 64505 TELECOMMUNICATIONS CARRIER LINE CH ANNUAL MEMBERSHIPADMIN SVCS/FACILITIESBEST BUY 0000313719.99$ 12/01/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR 12 VOLT TRANSFORMERADMIN SVCS/FACILITIESHOH WATER TECHNOLOGY95.00$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL CHEMICAL MATERIALSADMIN SVCS/FACILITIESHOH WATER TECHNOLOGY95.00$ 12/01/2017 62295 TRAINING & TRAVEL CHEMICAL TRAININGADMIN SVCS/FACILITIESLEMOI ACE HARDWARE28.97$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERASADMIN SVCS/FACILITIESRA ADAMS ENTERPRISES I400.00$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL SALT SPREADERADMIN SVCS/FACILITIESSTANDARD PIPE93.93$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL EYEWASH STATIONADMIN SVCS/FACILITIESSTANDARD PIPE156.31$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL PVC MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 1902287.25$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERA MATERIALADMIN SVCS/FACILITIESTHE HOME DEPOT 190244.60$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL OLD GENERATOR ROOM REPAIRSADMIN SVCS/FACILITIESTHE HOME DEPOT 190247.92$ 12/01/2017 65050 BUILDING MAINTENANCE MATERIAL PAINTING MATERIALSADMIN SVCS/FACILITIESABLE DISTRIBUTORS19.69$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL REPAIR DRYER VENTADMIN SVCS/FACILITIESANDERSON PEST SOLUTION110.21$ 12/04/2017 62225 BLDG MAINT SVCS PEST SERVICE CHURCH GARAGEADMIN SVCS/FACILITIESANDERSON PEST SOLUTION106.09$ 12/04/2017 62225 BLDG MAINT SVCS PEST SERVICE MAPLE GARAGEADMIN SVCS/FACILITIESCLAIM ADJ/VZWRLSS ETM SFL1434901(443.83)$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL FRAUDULENT CHARGE REFUNDADMIN SVCS/FACILITIESCLAIM ADJ/VZWRLSS ETM SFL1434901(443.83)$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL FRAUDULENT CHARGE REFUNDADMIN SVCS/FACILITIESCLAIM ADJ/VZWRLSS ETM SFL1434901(443.83)$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL FRAUDULENT CHARGE REFUNDADMIN SVCS/FACILITIESCONNEXION7.50$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL LIGHT SWITCH GUARDADMIN SVCS/FACILITIESEVANSTON SIGNS AND GRA133.00$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL DELIVERY SIGNSADMIN SVCS/FACILITIESRA ADAMS ENTERPRISES I1,244.25$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL SALT SPREADERADMIN SVCS/FACILITIESRA ADAMS ENTERPRISES I1,244.25$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL SALT SPREADER FOR VEHICLE 145ADMIN SVCS/FACILITIESSOUTHSIDE CONTROL218.83$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL GAS VALVEADMIN SVCS/FACILITIESSQU SQ MIDWEST ENVIRO1,488.70$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR CO-RAY HEATERSADMIN SVCS/FACILITIESSQU SQ MIDWEST ENVIRO821.33$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL SERVICE CENTER D BUILDING HVAC MATERIALSADMIN SVCS/FACILITIESSTANDARD PIPE241.20$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL FAUCET REPAIR PARTSADMIN SVCS/FACILITIESSTANDARD PIPE67.96$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL TOILET REPAIRADMIN SVCS/FACILITIESSTANDARD PIPE793.82$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL TRIPLE BASIN COVERSADMIN SVCS/FACILITIESTHE HOME DEPOT 19025.62$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL BABY CHANGING STATION MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 190263.94$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL BATTERIESADMIN SVCS/FACILITIESTHE HOME DEPOT 190259.69$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL OFFICE REMODEL MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 190255.88$ 12/04/2017 65085 MINOR EQUIP & TOOLS SAW AND SCREWDRIVERSADMIN SVCS/FACILITIESTHE HOME DEPOT 1902136.17$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL SPARE MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 19023.34$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL SPARE PARTSADMIN SVCS/FACILITIESTHE HOME DEPOT 19025.97$ 12/04/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR TRUCKADMIN SVCS/FACILITIESVARIDESK472.82$ 12/04/2017 62490 OTHER PROGRAM COSTS SIT STAND DESK FOR HEALTH DEPARTMENTADMIN SVCS/FACILITIESWW GRAINGER25.64$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL QUICK DISCONNECT FOR CAR WASHADMIN SVCS/FACILITIESABLE DISTRIBUTORS24.94$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL FUSE POPPERADMIN SVCS/FACILITIESCONNEXION21.62$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL LIGHTINGADMIN SVCS/FACILITIESPURE ELECTRIC411.25$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL LIGHTINGADMIN SVCS/FACILITIESSTANDARD PIPE24.11$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL REPAIR UPSTAIRS SINKADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,090.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE FIRE 1 AND LEVYADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,090.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE FIRE 3 AND RECYCLING CENTERADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,180.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE FIRE 4 AND 2ADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,190.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE LIBRARY AND MAPLE GARAGEADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,090.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE NOYES AND CROWNADMIN SVCS/FACILITIESUNITES STATES FIRE PRO1,240.00$ 12/05/2017 62225 BLDG MAINT SVCS ANNUAL PREVENTATIVE MAINTENANCE SERVICE CENTER AND FIRE 5ADMIN SVCS/FACILITIESEVANSTON GLASS AND MIR695.00$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL GLASS REPAIRSADMIN SVCS/FACILITIESGORDONGLASSUSACOM143.45$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL WINDOW PARTSADMIN SVCS/FACILITIESKWS KLINGSPOR WOODWORK363.94$ 12/06/2017 65085 MINOR EQUIP & TOOLS TOOLSADMIN SVCS/FACILITIESOFFICE DEPOT #51087.40$ 12/06/2017 65095 OFFICE SUPPLIES OFFICE SUPPLIESADMIN SVCS/FACILITIESPURE ELECTRIC374.06$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL EMERGENCY LIGHT INSTALLATIONADMIN SVCS/FACILITIESPURE ELECTRIC181.64$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL PARK LIGHTSADMIN SVCS/FACILITIESTHE HOME DEPOT 1902146.45$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL SALT AND PAINT MATERIALSADMIN SVCS/FACILITIESWALGREENS #26196.59$ 12/06/2017 65095 OFFICE SUPPLIES RETIREMENT CARDADMIN SVCS/FACILITIESWW GRAINGER215.68$ 12/06/2017 65050 BUILDING MAINTENANCE MATERIAL FUSES FOR PUMPSADMIN SVCS/FACILITIESABLE DISTRIBUTORS104.45$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL NEW STAT FOR PARKADMIN SVCS/FACILITIESCONNEXION67.73$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL BALL DIAMOND LIGHTSADMIN SVCS/FACILITIESINTERNATIONAL TRANSACTION FEE3.82$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL INTERNATIONAL TRANSACTION FEE FOR MATERIAL PURCHASE FROM CANADAADMIN SVCS/FACILITIESLEMOI ACE HARDWARE14.98$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL THRESHOLDADMIN SVCS/FACILITIESPURE ELECTRIC363.66$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERA MATERIALSADMIN SVCS/FACILITIESPURE ELECTRIC69.25$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL LIGHTINGADMIN SVCS/FACILITIESREFLECT WINDOW & DOOR476.88$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL WINDOW PARTSFebruary 12, 2018Page 1 of 1160 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONADMIN SVCS/FACILITIESTHE HOME DEPOT 19023.72$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL EJECTOR PUMP REPLACMENTADMIN SVCS/FACILITIESWW GRAINGER76.92$ 12/07/2017 65050 BUILDING MAINTENANCE MATERIAL QUICK DISCONNECT FOR CAR WASHADMIN SVCS/FACILITIESABLE DISTRIBUTORS42.68$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL GAS REGULATORS FOR HEATERSADMIN SVCS/FACILITIESEVANSTON LUMBER32.08$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIALS FOR RETIREMENT PLAQUEADMIN SVCS/FACILITIESSTANDARD PIPE660.38$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL SPARE PLUMBING PARTSADMIN SVCS/FACILITIESTHE HOME DEPOT 1902214.85$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERA MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 190253.21$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL KNEE PADS AND MAGNETIC TRAYADMIN SVCS/FACILITIESCITY WELDING SALES & S315.66$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL TANK FILLS FOR FORKLIFTADMIN SVCS/FACILITIESCONNEXION18.90$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL FUSE FOR HEATERADMIN SVCS/FACILITIESEVANSTON SIGNS AND GRA30.00$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL SIGNAGEADMIN SVCS/FACILITIESHAROLD'S TRUE VALUE HD9.98$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL THERMOMETERADMIN SVCS/FACILITIESLEMOI ACE HARDWARE8.62$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIALS FOR RETIREMENT PLAQUEADMIN SVCS/FACILITIESRIXON CUSTOM EQUIPMENT320.00$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL DOOR SENSORADMIN SVCS/FACILITIESSMITHEREEN PEST MANAGE150.00$ 12/11/2017 62225 BLDG MAINT SVCS PEST CONTROLADMIN SVCS/FACILITIESSMYLIE BROS. RESTAURAN127.25$ 12/11/2017 65095 OFFICE SUPPLIES SUPERVISOR MEETINGADMIN SVCS/FACILITIESSTANDARD PIPE14.52$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL PLUMBING PARTSADMIN SVCS/FACILITIESSTARBUCKS STORE 0024310.40$ 12/11/2017 65090 SAFETY EQUIPMENT COLD WEATHER BEVERAGESADMIN SVCS/FACILITIESTHE HOME DEPOT #1902805.62$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL REMODELING MATERIALS FOR RM 3000ADMIN SVCS/FACILITIESTHE HOME DEPOT 19027.87$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL FLOOR MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT 1902158.60$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL PAINT AND SUPPLIESADMIN SVCS/FACILITIESTHE HOME DEPOT 190245.56$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL SINK MATERIALSADMIN SVCS/FACILITIESABLE DISTRIBUTORS217.19$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL GLYCOL LEAK REPAIRSADMIN SVCS/FACILITIESINT IN MECHANICAL EQU185.40$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL FLAME SENSORADMIN SVCS/FACILITIESJ J KELLER & ASSOCIATE1,007.00$ 12/12/2017 65090 SAFETY EQUIPMENT MOTOR CARRIER SAFETY REPORT FIVE YEAR SUBSCRIPTIONADMIN SVCS/FACILITIESLEMOI ACE HARDWARE34.01$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL SHOP STOCKADMIN SVCS/FACILITIESPURE ELECTRIC46.20$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL HVAC HEATER DISCONNECTADMIN SVCS/FACILITIESSTANDARD PIPE60.95$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL BATH RENOVATIONSADMIN SVCS/FACILITIESSTANDARD PIPE42.38$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL CONDENSATE REPAIRSADMIN SVCS/FACILITIESSTANDARD PIPE353.20$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL PLUMBING PARTSADMIN SVCS/FACILITIESSTANDARD PIPE54.99$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL SPARE PARTSADMIN SVCS/FACILITIESWW GRAINGER98.70$ 12/12/2017 65050 BUILDING MAINTENANCE MATERIAL PIPE INSULATIONADMIN SVCS/FACILITIESGIH GLOBALINDUSTRIALEQ190.20$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL ENTRY MATSADMIN SVCS/FACILITIESPURE ELECTRIC126.68$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERA MATERIALSADMIN SVCS/FACILITIESPURE ELECTRIC46.20$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL HVAC HEATER DISCONNECTADMIN SVCS/FACILITIESSHERWIN WILLIAMS 70370856.17$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL WHITE BOARD PAINTADMIN SVCS/FACILITIESTHE HOME DEPOT 190277.81$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL GLYCOL LOOP REPAIRADMIN SVCS/FACILITIESTHE HOME DEPOT 190221.00$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL GLYCOL LOOP REPAIRADMIN SVCS/FACILITIESTHE HOME DEPOT 1902111.41$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR THE MAYORS OFFICEADMIN SVCS/FACILITIESTHE HOME DEPOT 1902201.89$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL PAINT AND PICTURE HOOKSADMIN SVCS/FACILITIESTHE HOME DEPOT 19027.97$ 12/13/2017 65085 MINOR EQUIP & TOOLS SERVICE TOOLSADMIN SVCS/FACILITIESTHE HOME DEPOT 190274.53$ 12/13/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR TRUCK AND MENORAH INSTALLATIONADMIN SVCS/FACILITIESWW GRAINGER310.56$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL REPLACEMENT LIGHTSADMIN SVCS/FACILITIESABLE DISTRIBUTORS628.80$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL HEATERS AND THERMOSTATSADMIN SVCS/FACILITIESGREY'S APPLIANCE REPAI310.00$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL APPLIANCE REPAIRSADMIN SVCS/FACILITIESJOHNSON LOCKSMITH INC11.00$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL DESK KEYSADMIN SVCS/FACILITIESJOHNSTONE SUPPLY OF NI112.50$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL MAYORS OFFICE MATERIALSADMIN SVCS/FACILITIESLEMOI ACE HARDWARE19.16$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL SHOP STOCKADMIN SVCS/FACILITIESPURE ELECTRIC312.12$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESPURE ELECTRIC79.85$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL HVAC HEATERADMIN SVCS/FACILITIESPURE ELECTRIC216.99$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL MAYORS OFFICE MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #190214.92$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL BUILDING SUPPLIESADMIN SVCS/FACILITIESTHE HOME DEPOT #1902173.96$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR THE MAYORS OFFICEADMIN SVCS/FACILITIESTHE HOME DEPOT 190233.88$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL BODY CAMERA DOCKSADMIN SVCS/FACILITIESTHE HOME DEPOT 190243.93$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL FITNESS ROOM MIRROR MATERIALSADMIN SVCS/FACILITIESABLE DISTRIBUTORS15.67$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL FREIGHT CHARGEADMIN SVCS/FACILITIESH-MAC SYSTEMS. INC1,232.40$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL NEW HEATERS FOR GARAGEADMIN SVCS/FACILITIESJC LICHT - 1252 - EVAN144.33$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIALS FOR PAINTINGADMIN SVCS/FACILITIESJC LICHT - 1252 - EVAN426.88$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL PAINTING MATERIALSADMIN SVCS/FACILITIESNORTH SHORE FAUCETS32.74$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL TOILET REPAIRSADMIN SVCS/FACILITIESTHE HOME DEPOT #1902320.41$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL MAYORS OFFICE MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #190210.97$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL WHITE BOARD TRIMADMIN SVCS/FACILITIESTHE HOME DEPOT 190232.29$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL PLUMBING PARTSADMIN SVCS/FACILITIES4TE ILST FIRE MARSHAL70.00$ 12/18/2017 62225 BLDG MAINT SVCS HEAT EXCHANGER STATE INSPECTIONADMIN SVCS/FACILITIES4TE ILST FIREMARSLSFEE1.65$ 12/18/2017 62225 BLDG MAINT SVCS HEAT EXCHANGER STATE INSPECTION FEEADMIN SVCS/FACILITIESDREISILKER ELECTRIC MO99.84$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL HEATER MOTORFebruary 12, 2018Page 2 of 1161 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONADMIN SVCS/FACILITIESEVANSTON LUMBER49.00$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR MAYORS OFFICEADMIN SVCS/FACILITIESHOH WATER TECHNOLOGY706.22$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL AUTOMATE CHEMICAL FEEDADMIN SVCS/FACILITIESPURE ELECTRIC296.04$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL FLAG LIGHTSADMIN SVCS/FACILITIESPURE ELECTRIC248.80$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL SERVICE CENTER STOCKADMIN SVCS/FACILITIESSAMS CLUB #6444154.31$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESSTANDARD PIPE59.40$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL HOT WATER REPAIRSADMIN SVCS/FACILITIESTHE HOME DEPOT #190218.84$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL BUILDING HEATADMIN SVCS/FACILITIESTHE HOME DEPOT #1902117.48$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL PLYWOODADMIN SVCS/FACILITIESTHE HOME DEPOT #190290.58$ 12/18/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR SHOPADMIN SVCS/FACILITIESTHE HOME DEPOT 190267.55$ 12/18/2017 65050 BUILDING MAINTENANCE MATERIAL HVAC PIPINGADMIN SVCS/FACILITIESABLE DISTRIBUTORS357.95$ 12/19/2017 65050 BUILDING MAINTENANCE MATERIAL THERMOSTAT COVERSADMIN SVCS/FACILITIESANDERSON LOCK CO187.77$ 12/19/2017 65050 BUILDING MAINTENANCE MATERIAL OFFICE DOORADMIN SVCS/FACILITIESLEMOI ACE HARDWARE9.45$ 12/19/2017 65085 MINOR EQUIP & TOOLS DRILL BITS AND NUTS AND BOLTSADMIN SVCS/FACILITIESPURE ELECTRIC42.24$ 12/19/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESPURE ELECTRIC123.76$ 12/19/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESABLE DISTRIBUTORS36.02$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL NEW HUMIDIFIER PADSADMIN SVCS/FACILITIESJEWEL #345640.37$ 12/20/2017 65095 OFFICE SUPPLIES STAFF MEETINGADMIN SVCS/FACILITIESSAMS CLUB #644472.30$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESSAMSCLUB #64448.64$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESSAMSCLUB #6444189.99$ 12/20/2017 68205 PUBLIC WKS CONTINGENCIES PWA HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #19028.22$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL THERMOSTAT MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #190215.65$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL WHITE BOARD CASINGADMIN SVCS/FACILITIESTHE HOME DEPOT 190250.77$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL TO LOCATE ODOR ISSUEADMIN SVCS/FACILITIESCONNEXION56.73$ 12/21/2017 65050 BUILDING MAINTENANCE MATERIAL HANGING HEATERS IN MAPLE GARAGEADMIN SVCS/FACILITIESPORTILLOS HOT DOGS #2860.00$ 12/21/2017 65095 OFFICE SUPPLIES EMPLOYEE RECOGNITION LUNCHADMIN SVCS/FACILITIESPURE ELECTRIC318.33$ 12/21/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESPURE ELECTRIC184.95$ 12/21/2017 65050 BUILDING MAINTENANCE MATERIAL GENERAL ELECTRICAL SUPPLIESADMIN SVCS/FACILITIESSAMSCLUB #644474.54$ 12/21/2017 68205 PUBLIC WKS CONTINGENCIES PWA HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #190270.58$ 12/21/2017 65050 BUILDING MAINTENANCE MATERIAL CIVIC CENTER REPAIRS MATERIALSADMIN SVCS/FACILITIESLEMOI ACE HARDWARE8.90$ 12/22/2017 65050 BUILDING MAINTENANCE MATERIAL FRONT DOORADMIN SVCS/FACILITIESPURE ELECTRIC20.37$ 12/22/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESSTANDARD PIPE207.34$ 12/22/2017 65050 BUILDING MAINTENANCE MATERIAL SPARE MATERIALSADMIN SVCS/FACILITIESTHE HOME DEPOT #1902211.62$ 12/22/2017 65050 BUILDING MAINTENANCE MATERIAL ELEVATOR ROOMADMIN SVCS/FACILITIESTHE HOME DEPOT #1902137.64$ 12/22/2017 65050 BUILDING MAINTENANCE MATERIAL TRAP REPAIR IN APPARATUS FLOWADMIN SVCS/FACILITIESABLE DISTRIBUTORS60.08$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL BELTS AND PIPINGADMIN SVCS/FACILITIESH-MAC SYSTEMS. INC76.59$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL HANGING HEATER IN STAIRWELLADMIN SVCS/FACILITIESPURE ELECTRIC354.90$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL MAYORS OFFICE AND PDHQ MATERIALSADMIN SVCS/FACILITIESPURE ELECTRIC658.08$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL SHOP STOCKADMIN SVCS/FACILITIESSIUE EMARKET525.00$ 12/26/2017 62295 TRAINING & TRAVEL RPZ TRAINING COURSEADMIN SVCS/FACILITIESTHE HOME DEPOT #190282.70$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL PLUMBING PARTSADMIN SVCS/FACILITIESTHE HOME DEPOT #190278.47$ 12/26/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR MAYORS OFFICE REMODELADMIN SVCS/FACILITIESTHE HOME DEPOT #190287.82$ 12/26/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR SHOPADMIN SVCS/FACILITIESDD/BR #338026 Q358.76$ 12/27/2017 65095 OFFICE SUPPLIES COFFEE FOR MEETINGADMIN SVCS/FACILITIESPURE ELECTRIC180.15$ 12/27/2017 65050 BUILDING MAINTENANCE MATERIAL ELECTRICAL MATERIALS FOR GIBBS MORRISONADMIN SVCS/FACILITIESSTANDARD PIPE121.20$ 12/27/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRADMIN SVCS/FACILITIESSTANDARD PIPE189.90$ 12/27/2017 65050 BUILDING MAINTENANCE MATERIAL TOILET REPAIR PARTSADMIN SVCS/FACILITIESABLE DISTRIBUTORS46.08$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL FILTERSADMIN SVCS/FACILITIESANDERSON LOCK CO610.63$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL CHANGE IN LOCK SETADMIN SVCS/FACILITIESANDERSON LOCK CO316.50$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL LOCK CHANGESADMIN SVCS/FACILITIESBURGER KING #1664 Q0746.86$ 12/28/2017 65095 OFFICE SUPPLIES STAFF LUNCHADMIN SVCS/FACILITIESNATIONAL LIFT TRUCK1,000.00$ 12/28/2017 62225 BLDG MAINT SVCS LIFT REPAIRADMIN SVCS/FACILITIESNATIONAL LIFT TRUCK1,000.00$ 12/28/2017 62225 BLDG MAINT SVCS LIFT REPAIRADMIN SVCS/FACILITIESNATIONAL LIFT TRUCK1,000.00$ 12/28/2017 62225 BLDG MAINT SVCS LIFT REPAIRADMIN SVCS/FACILITIESNATIONAL LIFT TRUCK167.75$ 12/28/2017 62225 BLDG MAINT SVCS LIFT REPAIRADMIN SVCS/FACILITIESSTANDARD PIPE671.50$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRSADMIN SVCS/FACILITIESSTANDARD PIPE526.40$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRSADMIN SVCS/FACILITIESSTANDARD PIPE117.26$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRSADMIN SVCS/FACILITIESTHE HOME DEPOT #1902256.90$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRADMIN SVCS/FACILITIESTHE HOME DEPOT #19028.90$ 12/28/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR WOMEN'S RESTROOMADMIN SVCS/FACILITIESUFIRST LAUNDRY SVCS131.00$ 12/28/2017 62225 BLDG MAINT SVCS MONTHLY MAT SERVICEADMIN SVCS/FACILITIESANDERSON LOCK CO182.35$ 12/29/2017 65050 BUILDING MAINTENANCE MATERIAL BACK UP MORTISE BOXADMIN SVCS/FACILITIESANDERSON LOCK CO317.81$ 12/29/2017 65050 BUILDING MAINTENANCE MATERIAL HANDICAP DOOR MATERIALSADMIN SVCS/FACILITIESPURE ELECTRIC455.80$ 12/29/2017 65050 BUILDING MAINTENANCE MATERIAL AIR HANDLER FEEDSADMIN SVCS/FACILITIESTHE HOME DEPOT #1902187.59$ 12/29/2017 65050 BUILDING MAINTENANCE MATERIAL FROZEN PIPE REPAIRADMIN SVCS/FACILITIESTHE HOME DEPOT #1902233.63$ 12/29/2017 65050 BUILDING MAINTENANCE MATERIAL PAINT AND SUPPLIESFebruary 12, 2018Page 3 of 1162 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONADMIN SVCS/FLEETIL TOLLWAY AUTO REPLEN40.00$ 12/04/2017 65060 MATERIALS TO MAINTAIN AUTOS IPASS AUTO REPLENISHMENTADMIN SVCS/FLEETMSC31.80$ 12/05/2017 65060 MATERIALS TO MAINTAIN AUTOS SPECIALTY HITCH PINSADMIN SVCS/FLEETIL TOLLWAY AUTO REPLEN40.00$ 12/13/2017 65060 MATERIALS TO MAINTAIN AUTOS IPASS REPLENISHMENTADMIN SVCS/FLEETIMPERIAL SUPPLIES124.78$ 12/13/2017 65060 MATERIALS TO MAINTAIN AUTOS DRILL BITSADMIN SVCS/FLEETAC BRETT EQUIPMENT CO36.61$ 12/21/2017 65060 MATERIALS TO MAINTAIN AUTOS LED MARKER LIGHTSADMIN SVCS/FLEETIMPERIAL SUPPLIES69.47$ 12/22/2017 65060 MATERIALS TO MAINTAIN AUTOS QUICK COUPLER AND CLAMPADMIN SVCS/HUMAN RESSHRM MEMBER600762719179.00$ 12/01/2017 62360 MEMBERSHIP DUES SHRM MEMBERSHIP DANKWAADMIN SVCS/HUMAN RESJIMMY JOHNS - 44 - MOT153.38$ 12/08/2017 65125 OTHER COMMODITIES SAFETY RECOGNITION LUNCHADMIN SVCS/HUMAN RESINTERNATION445.50$ 12/11/2017 62512 RECRUITMENT SERVICES JOB POSTING - CMOADMIN SVCS/HUMAN RESINTERNATION(222.75)$ 12/12/2017 62512 RECRUITMENT SERVICES JOB POSTING DISCOUNT CREDITADMIN SVCS/HUMAN RESTACO DIABLO - LULUS -75.00$ 12/12/2017 65125 OTHER COMMODITIES HOLIDAY LUNCHADMIN SVCS/HUMAN RESACCURATE BIOMETRICS IN474.00$ 12/14/2017 65095 OFFICE SUPPLIES LIBRARY FINGERPRINTINGADMIN SVCS/HUMAN RESJIMMY JOHNS - 44 - MOT90.08$ 12/14/2017 65125 OTHER COMMODITIES SAFETY RECOGNITION LUNCHADMIN SVCS/HUMAN RESBOXWOOD TECHNOLOGY199.00$ 12/15/2017 62512 RECRUITMENT SERVICES JOB POSTING - CMOADMIN SVCS/HUMAN RESEQF TALX CORPORATION35.95$ 12/15/2017 62160 EMPLOYMENT TESTING SERVICES EMPLOYMENT VERIFICATIONADMIN SVCS/HUMAN RESPROGRESSIVE BUSINESS P299.00$ 12/15/2017 65010 BOOKS, PUBLICATIONS, MAPS PAYROLL UPDATES - SUBSCRIPTIONADMIN SVCS/HUMAN RESBOXWOOD TECHNOLOGY350.00$ 12/18/2017 62512 RECRUITMENT SERVICES JOB POSTING - CMOADMIN SVCS/HUMAN RESBOXWOOD TECHNOLOGY350.00$ 12/18/2017 62512 RECRUITMENT SERVICES JOB POSTING - CMOADMIN SVCS/HUMAN RESJIMMY JOHNS - 44 - MOT195.32$ 12/18/2017 65125 OTHER COMMODITIES SAFETY RECOGNITION LUNCHADMIN SVCS/HUMAN RESPAYPAL INTERNATION(75.00)$ 12/19/2017 62512 RECRUITMENT SERVICES ERROR, CREDITEDADMIN SVCS/HUMAN RESPAYPAL INTERNATION75.00$ 12/19/2017 62512 RECRUITMENT SERVICES ERROR, CREDITEDADMIN SVCS/HUMAN RESPHYSICIANS URGENT CARE20.00$ 12/19/2017 62160 EMPLOYMENT TESTING SERVICES PRE-EMPLOYMENT DRUG TESTINGADMIN SVCS/HUMAN RESGOVERNMENT FINANCE150.00$ 12/21/2017 62512 RECRUITMENT SERVICES JOB POSTING - CMOADMN SERVICESSQU SQ EVENTS BY JOEY2,500.00$ 12/01/2017 66040 GENERAL ADMINISTRATION DEPOSIT ON CATERING FOR A BRIGHT NIGHT IN ARTS EVENT IN JANUARYADMN SERVICESJEWEL #3456135.97$ 12/11/2017 65025 FOOD REFRESHMENTS AND CAKE FOR RETIREMENT CELEBRATION FOR RICKEY VOSSADMN SERVICESJIMMY JOHNS - 44 - MOT67.99$ 12/11/2017 65025 FOOD REFRESHMENTS FOR RETIREMENT PARTY FOR RICKEY VOSSADMN SERVICESAVI SYSTEMS INC4,125.00$ 12/12/2017 64004 PEG FEE DISTRIBUTION COUNCIL CHAMBERS AUDIO VISUAL SUPPORTADMN SVCS/INFO SYSDMI DELL HIGHER EDUC379.79$ 12/01/2017 62250 COMPUTER EQUIPMENT MAINT. #17123 DEVON REID REPLACEMENT CHROMEBOOKADMN SVCS/INFO SYSCITY OF EVANSTON- METE2.00$ 12/04/2017 62295 TRAINING & TRAVEL PARKING METER PAYMENT FOR MEETING TRAVELADMN SVCS/INFO SYSD J WALL-ST-JOURNAL36.99$ 12/04/2017 62295 TRAINING & TRAVEL SUBSCRIPTION SERVICESADMN SVCS/INFO SYSLINKEDIN-351 8275664455.00$ 12/04/2017 62205 ADVERTISING RECRUITMENT ADVERTISEMENTADMN SVCS/INFO SYSLOGISTYX TECHNOLOGIES4,614.75$ 12/04/2017 62340 IS SUPPORT FEES SIX CAR PRINTERS FOR POLICE VEHICLESADMN SVCS/INFO SYSBIZNESSAPPS59.00$ 12/07/2017 62662 BUSINESS RETENTION/EXPANSION INVES EVANSTON EXPLORER APPADMN SVCS/INFO SYSCDW GOVT #LBF7451119.15$ 12/07/2017 62250 COMPUTER EQUIPMENT MAINT. #16470 REPLACEMENT BATTERY FOR PANASONIC CF-54ADMN SVCS/INFO SYSVILLAGE OF ROSEMONT15.00$ 12/07/2017 62295 TRAINING & TRAVEL CISCO LIVE CONFERENCE IN ROSEMONTADMN SVCS/INFO SYSHEARTLAND BUSINESS SYS3,300.00$ 12/08/2017 62340 IS SUPPORT FEES PROFESSIONAL SERVICES HOURS BLOCK - CISCO ISE AND FIREPOWERADMN SVCS/INFO SYSPLUG N PAY INC15.00$ 12/08/2017 62705 BANK SERVICE CHARGES BANK CHARGES PARKS AND REC APPADMN SVCS/INFO SYSPLUG N PAY INC15.00$ 12/08/2017 62705 BANK SERVICE CHARGES BANK CHARGES PARKS AND REC BANK APPSADMN SVCS/INFO SYSSENTINEL TECHNOLOGIES927.00$ 12/08/2017 64510 TELECOMM EQ (IS) CISCO POE INJECTORS - SOUTH END CAMERASADMN SVCS/INFO SYSHEARTLAND BUSINESS SYS1,918.45$ 12/11/2017 64510 TELECOMM EQ (IS) CISCO WIRELESS LICENSESADMN SVCS/INFO SYSVILLAGE OF ROSEMONT15.00$ 12/11/2017 62295 TRAINING & TRAVEL CAMP IT CONFERENCE - ROSEMONT PARKINGADMN SVCS/INFO SYSLINKEDIN-352 6436164162.50$ 12/12/2017 62205 ADVERTISING RECRUITING ADVERTISINGADMN SVCS/INFO SYSINTERPARK - 516 N RUSH46.00$ 12/13/2017 62295 TRAINING & TRAVEL PARKING METER PAYMENT FOR MEETING TRAVELADMN SVCS/INFO SYSEDITME49.00$ 12/14/2017 62340 IS SUPPORT FEES WEB SITE SOFTWARE SUBCRIPTIONADMN SVCS/INFO SYSLOGISTYX TECHNOLOGIES(419.52)$ 12/14/2017 62340 IS SUPPORT FEES SALES TAX REVERSALADMN SVCS/INFO SYSTHE HOME DEPOT #19024.36$ 12/14/2017 64515 TELECOMM EQUIP MAINTENANCE LEVY CENTER - WIRELESS AP INSTALL - TOGGLE BOLTSADMN SVCS/INFO SYSBUILT IN69.00$ 12/18/2017 62205 ADVERTISING RECRUITMENT ADVERTISINGADMN SVCS/INFO SYSCITY OF EVENSTON2.00$ 12/18/2017 62295 TRAINING & TRAVEL MEETING AT EPL MAIN BRANCHADMN SVCS/INFO SYSOFFICE DEPOT #510229.99$ 12/18/2017 65095 OFFICE SUPPLIES OFFICE SUPPLIESADMN SVCS/INFO SYSBESTBUYCOM805521439546150.14$ 12/19/2017 65095 OFFICE SUPPLIES IT DEPT SUPPLIESADMN SVCS/INFO SYSCITY OF EVENSTON2.00$ 12/19/2017 62295 TRAINING & TRAVEL MEETING FOR FOUNTAIN SQUARE CONSTRUCTIONADMN SVCS/INFO SYSASANA.COM112.50$ 12/22/2017 62340 IS SUPPORT FEES PROJECT MANAGEMENT SOFTWARE SUBSCRIPTIONADMN SVCS/INFO SYSLINCOLN TOWING218.50$ 12/22/2017 64510 TELECOMM EQ (IS) 415 HOWARD - SOUTH END CAMERAADMN SVCS/INFO SYSBANGERS AND LACE - EVA118.30$ 12/26/2017 65025 FOOD HOLIDAY DINNER IT DEPARTMENTADMN SVCS/INFO SYSHELLO HELLOFAX79.91$ 12/26/2017 62340 IS SUPPORT FEES FAX SERVICESADMN SVCS/INFO SYSISSUU19.00$ 12/26/2017 62340 IS SUPPORT FEES WEB SITE DOCUMENT SOFTWARE SUBSCRIPTIONADMN SVCS/INFO SYSMSFT E07004ZVWB74.40$ 12/27/2017 62341 INTERNET SOLUTION PROVIDERS MICROSOFT AZURE - BEACH PREDICTION TOOL HOSTINGADMN SVCS/PARKIING SVCSCITY OF EVENSTON1.00$ 12/04/2017 62230 SVC TO MAINTAIN MAINS TESTING METERSADMN SVCS/PARKIING SVCSEVANSTON SIGNS AND GRA196.00$ 12/04/2017 62230 SVC TO MAINTAIN MAINS SIGNAGE FOR LOT 69ADMN SVCS/PARKIING SVCSGIORDANOS OF EVANSTON122.68$ 12/04/2017 62295 TRAINING & TRAVEL PASSPORT DEVELOPMENT MEETINGADMN SVCS/PARKIING SVCSCITY OF EVANSTON MOBIL1.35$ 12/07/2017 62230 SVC TO MAINTAIN MAINS METER TESTINGADMN SVCS/PARKIING SVCSCITY OF EVENSTON0.25$ 12/07/2017 62230 SVC TO MAINTAIN MAINS TESTING METERSADMN SVCS/PARKIING SVCSCITY OF EVENSTON0.25$ 12/07/2017 62230 SVC TO MAINTAIN MAINS TESTING METERSADMN SVCS/PARKIING SVCSCITY OF EVENSTON0.25$ 12/07/2017 62230 SVC TO MAINTAIN MAINS TESTING METERSADMN SVCS/PARKIING SVCSLEMOI ACE HARDWARE22.96$ 12/07/2017 62230 SVC TO MAINTAIN MAINS SPRAY PAINT FOR METERSFebruary 12, 2018Page 4 of 1163 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONADMN SVCS/PARKIING SVCSOFFICE DEPOT #51049.47$ 12/07/2017 62230 SVC TO MAINTAIN MAINS LABEL MAKER FOR METERSADMN SVCS/PARKIING SVCSTHINGS REMEMBERED 060280.74$ 12/08/2017 62230 SVC TO MAINTAIN MAINS METER PLACARDADMN SVCS/PARKIING SVCSTHE HOME DEPOT #190273.50$ 12/14/2017 62230 SVC TO MAINTAIN MAINS SHOVELS FOR CLEANING SNOW AROUND METERS AND PAY BOXESADMN SVCS/PARKIING SVCSCITY OF EVENSTON1.00$ 12/15/2017 62230 SVC TO MAINTAIN MAINS METER TESTINGADMN SVCS/PARKIING SVCSCITY OF EVENSTON2.00$ 12/15/2017 65045 LICENSING/REGULATORY SUPPLIES TEST PARKING SESSION FOR PAY BY PLATE MACHINE ON 1700 SHERMANADMN SVCS/PARKIING SVCSGALLS97.48$ 12/18/2017 65045 LICENSING/REGULATORY SUPPLIES PEO BAGSADMN SVCS/PARKIING SVCSCARQUEST 2759117.78$ 12/28/2017 62230 SVC TO MAINTAIN MAINS BATTERY CHARGERS FOR PAY BOXESCITY COUNCIL ADMINSHERATON CHARLOTTE688.05$ 12/01/2017 62295 TRAINING & TRAVEL HOTEL FOR ALD. SIMMONS FOR NLC CONFERENCE IN CHARLOTTE, NC IN NOV 2017CITY COUNCIL ADMINUS CONF OF MAYORS650.00$ 12/01/2017 62295 TRAINING & TRAVEL REGISTRATION FEE FOR HAGERTY - US CONFERENCE OF MAYORS CONFERENCE JAN 2018 IN WASHINGTON, DCCITY COUNCIL ADMIN AMERICAN 0010613523057435.24$ 12/15/2017 62295 TRAINING & TRAVEL AIRFARE FOR US CONFERENCE OF MAYORS CONFERENCE IN WASHINGTON, DC JAN. 24-26, 2018 FOR MAYORCITY COUNCIL ADMIN AMERICAN 00121624400881292.40$ 12/15/2017 62295 TRAINING & TRAVEL AIRFARE FOR US CONFERENCE OF MAYORS CONFERENCE JAN. 24-26, 2018, WASHINGTON, DC FOR MAYORCITY COUNCIL ADMIN NATIONAL LEAGUE OF495.00$ 12/15/2017 62295 TRAINING & TRAVEL REGISTRATION FEE FOR NLC CONFERENCE IN WASHINGTON, DC MARCH 14-18, 2018 FOR ALD. SIMMONSCITY MGR'S OFFEB 2017 HOLIDAY LUNCH30.00$ 12/04/2017 62295 TRAINING & TRAVEL IAMMA LUNCH/SPEED COACHING - KIMBERLY RICHARDSONCITY MGR'S OFFJIMMY JOHNS - 44 - MOT23.87$ 12/05/2017 62605 OTHER CHARGES CITY MANAGER-ALDERMAN LUNCH MEETINGCITY MGR'S OFFUNITED 0162925921164613.99$ 12/08/2017 62295 TRAINING & TRAVEL INFLIGHT WI-FI FOR CITY MANAGERCITY MGR'S OFF22 - LOU MALNATIS PIZZ128.90$ 12/12/2017 65025 FOOD DINNER FOR CITY COUNCIL MEETING 12-11-17CITY MGR'S OFFWHOLEFDS GBR #1057064.13$ 12/12/2017 65025 FOOD FRUIT AND DESSERT FOR CITY COUNCIL MEETING 12-11-17CITY MGR'S OFFJIMMY JOHNS - 44 - MOT23.87$ 12/19/2017 62605 OTHER CHARGES CITY MANAGER-ALDERMAN LUNCH MEETINGCITY MGR'S OFFTAGS BAKERY111.80$ 12/20/2017 62605 OTHER CHARGES CAKE FOR MARTIN LYONS GOING-AWAY STAFF PARTYCITY MGR'S OFFNIU OUTREACH225.00$ 12/26/2017 62295 TRAINING & TRAVEL REGISTRATION FOR ILCMA WINTER CONFERENCE - WALLY BOBKIEWICZCMO/FINANCE ADMINTRIBUNE PUBLISHING COM2,016.00$ 12/06/2017 62205 ADVERTISING AD NOTICE BID 18-05 ASBESTOS ABATEMENT @ 721 HOWARD ST PROJECT # 617016 HOWARD STREET THEATERCMO/FINANCE ADMINTRIBUNE PUBLISHING COM76.29$ 12/12/2017 62180 STUDIES AD NOTICE BID 18-03 2018 SEWER FLOW MONITORINGCMO/FINANCE ADMINIPRA165.00$ 12/18/2017 62512 RECRUITMENT SERVICES RECRUITMENT ADVERTISINGCMO/FINANCE ADMINTAGS BAKERY47.70$ 12/19/2017 62295 TRAINING & TRAVEL FAREWELL FOR MARTY LYONSCMO/FINANCE ADMINTRIBUNE PUBLISHING COM81.89$ 12/19/2017 62145 ENGINEERING SERVICES AD NOTICE BID 18-02 SERVICE CENTER PARKING DECK RESTORATION PROJECT #617023 SERVICE CENTER EMERGENCY REPAIRSCMO/FINANCE ADMINTRIBUNE PUBLISHING COM69.09$ 12/19/2017 62662 BUSINESS RETENTION/EXPANSION INVES AD NOTICE RFP 18-04 2018 BUSINESS DISTRICT PLANTERS AND LANDSCAPE IMPROVEMENTSCMO/FINANCE ADMINTRIBUNE PUBLISHING COM1,988.00$ 12/20/2017 62205 ADVERTISING AD NOTICE BID 17-60 HOWARD STREET THEATER PROJECT # 617016 HOWARD STREET THEATERCMO/FINANCE ADMINPANINO'S PIZZERIA OR372.15$ 12/21/2017 62295 TRAINING & TRAVEL FAREWELL FOR MARTY LYONSCMO/FINANCE ADMINKNACK.COM79.00$ 12/28/2017 64545 (IS ONLY) PERSONAL COMP SOFTWARE MONTHLY KNACK RECEIPTCMO/FINANCE ADMINTRIBUNE PUBLISHING COM74.69$ 12/28/2017 65515 OTHER IMPROVEMENTS AD NOTICE BID 18-06 LOVELACE PARK POND REHABILITATION PROJECT #518004 LOVELACE PARK- POND REHABILITATIONCMO/FINANCE COMM ENGFACEBK W3GQGEJLX220.00$ 12/01/2017 62205 ADVERTISING BOOST TWO WINTER AWARENESS MESSAGESCMO/FINANCE COMM ENGFORMSTACK, LLC249.00$ 12/08/2017 64545 (IS ONLY) PERSONAL COMP SOFTWARE MONTHLY SUBSCRIPTION - FORM SOFTWARECMO/FINANCE COMM ENGGOOGLE GOOGLE STORAGE1.99$ 12/13/2017 64545 (IS ONLY) PERSONAL COMP SOFTWARE MONTHLY SOFTWARE SUBSCRIPTION -PHOTO STORAGECOMM ECON DEV/ADMINHILTON HOTELS1,726.92$ 12/01/2017 62662 BUSINESS RETENTION/EXPANSION INVES MAYOR'S CHALLENGE WORKSHOPCOMM ECON DEV/ADMINCHURCH STREET SELF PAR3.00$ 12/04/2017 62295 TRAINING & TRAVEL PARKING FOR ED PLANNING EVENT AT HYATT PLACECOMM ECON DEV/ADMINPEET'S #043045.56$ 12/04/2017 62662 BUSINESS RETENTION/EXPANSION INVES MEETING WITH CHEIFETZCOMM ECON DEV/ADMINCITY OF EVANSTON MOBIL2.35$ 12/06/2017 62295 TRAINING & TRAVEL PARKING FOR ALD. FISKE'S WARD MEETINGCOMM ECON DEV/ADMINAMERICAN PLANNING A417.00$ 12/12/2017 62360 MEMBERSHIP DUES APA MEMBERSHIP DUES - LEONARDCOMM ECON DEV/ADMINAPA-MEMBERSHIP ONLINE363.00$ 12/13/2017 62360 MEMBERSHIP DUES AICP MEMBERSHIP DUESCOMM ECON DEV/ADMINCITY OF EVANSTON- METE1.50$ 12/14/2017 62662 BUSINESS RETENTION/EXPANSION INVES MEETING AT 633 HOWARDCOMM ECON DEV/ADMINCITY OF EVANSTON MOBIL1.47$ 12/18/2017 62295 TRAINING & TRAVEL PARKING FOR MEETING WITH SUE LOELBACHCOMM ECON DEV/ADMINLAMBDA ALPHA INTERNATI280.00$ 12/18/2017 62360 MEMBERSHIP DUES LAI MEMBERSHIPCOMM ECON DEV/ADMINTHE HOME DEPOT #1902213.89$ 12/18/2017 62190 HOUSING REHAB SERVICES GRAFFITI REMOVAL SUPPLIESCOMM ECON DEV/ADMINTRIBUNE PUBLISHING COM76.29$ 12/19/2017 62205 ADVERTISING P & Z ADVERTISING - CHICAGO TRIBUNE ORDER NUMBER 5359168COMM ECON DEV/ADMINGOLDEN OLYMPIC RES129.20$ 12/20/2017 62662 BUSINESS RETENTION/EXPANSION INVES STAFF/DIRECTOR'S BREAKFAST MEETINGCOMM ECON DEV/ADMINTRIBUNE PUBLISHING COM65.89$ 12/21/2017 62205 ADVERTISING P & Z ADVERTISING - CHICAGO TRIBUNE ORDER NUMBER 5364821COMM ECON DEV/ADMINCITY OF EVANSTON MOBIL1.85$ 12/22/2017 62295 TRAINING & TRAVEL PARKING FOR LUNCH WITH KAREN SINGERCOMM ECON DEV/ADMINTRIBUNE PUBLISHING COM26.69$ 12/22/2017 62205 ADVERTISING ADVERTISING FEE - CHICAGO TRIBUNE AD - SALE OF 623 HOWARDCOMM ECON DEV/ADMINOVO FRITO CAFE36.40$ 12/26/2017 62662 BUSINESS RETENTION/EXPANSION INVES BREAKFAST MEETINGCOMM ECON DEV/ADMINTRIBUNE PUBLISHING COM40.29$ 12/26/2017 62205 ADVERTISING P & Z ADVERTISING - CHICAGO TRIBUNE ORDER NUMBER 5364933FIRE/ADMINANSTONOFFICE DEPOT #510(93.93)$ 12/04/2017 65095 OFFICE SUPPLIES CREDIT OFFICE SUPPLIESFIRE/ADMINANSTONTAGS BAKERY61.20$ 12/04/2017 65125 OTHER COMMODITIES PROMOTION CAKEFIRE/ADMINANSTONTHE HOME DEPOT 1902(34.85)$ 12/04/2017 65085 MINOR EQUIPMENT AND TOOLS CREDIT-RETURNFIRE/ADMINANSTONTHE HOME DEPOT 1902110.46$ 12/04/2017 65085 MINOR EQUIP & TOOLS REPAIR PARTSFIRE/ADMINANSTONTAGS BAKERY53.50$ 12/05/2017 65125 OTHER COMMODITIES EXPLORER PROGRAM GRADUATIONFIRE/ADMINANSTONVALLI PRODUCE12.89$ 12/06/2017 62295 TRAINING & TRAVEL EXPLORER PROGRAMFIRE/ADMINANSTONPANINO'S PIZZERIA OR120.00$ 12/07/2017 62295 TRAINING & TRAVEL EXPLORER PROGRAMFIRE/ADMINANSTONTODAY'S UNIFORMS189.95$ 12/11/2017 65125 OTHER COMMODITIES UNIFORM ARTICLESFIRE/ADMINANSTONSTATE CHEMIC STATE CHE117.70$ 12/12/2017 62210 PRINTING JANITORIAL SUPPLIESFIRE/ADMINANSTONSTATE CHEMIC STATE CHE173.34$ 12/13/2017 62210 PRINTING JANITORIAL SUPPLIESFIRE/ADMINANSTONSUPERIOR INDUSTRIAL SP51.81$ 12/13/2017 62210 PRINTING JANITORIAL SUPPLIESFebruary 12, 2018Page 5 of 1164 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONFIRE/ADMINANSTONTARGET 0000927487.89$ 12/13/2017 62210 PRINTING JANITORIAL SUPPLIESFIRE/ADMINANSTONTHE HOME DEPOT 190247.79$ 12/14/2017 65090 SAFETY EQUIPMENT REPAIR PARTSFIRE/ADMINANSTONMEDIC BATTERIES MEDIC264.06$ 12/15/2017 62521 MEDICAL EQUIP. MNTNC. AGREEMENT ALAKALINE BATTERIESFIRE/ADMINANSTONNFPA NATL FIRE PROTECT1,345.50$ 12/15/2017 65095 OFFICE SUPPLIES NFPA CODE SUBSCRIPTIONFIRE/ADMINANSTONSUPERIOR INDUSTRIAL SP276.70$ 12/15/2017 62210 PRINTING JANITORIAL SUPPLIESFIRE/ADMINANSTONGREY'S APPLIANCE REPAI130.00$ 12/20/2017 65050 BUILDING MAINTENANCE MATERIAL APPLIANCE REPAIRFIRE/ADMINANSTONTODAY'S UNIFORMS223.80$ 12/20/2017 65125 OTHER COMMODITIES UNIFORM ARTICLESFIRE/ADMINANSTONJONES & BARTLETT LEARN1,251.95$ 12/26/2017 65010 BOOKS, PUBLICATIONS, MAPS TRAINING BOOKSFIRE/ADMINANSTONWW GRAINGER91.26$ 12/29/2017 65075 MEDICAL & LAB SUPPLIES LIGHT BULBS STA 2HEALTHNORTHFIELD INN, SUITES237.30$ 12/01/2017 62295 TRAINING & TRAVEL RETAIL FOOD INSPECTION SEMINAR -G.OLSENHEALTHDD/BR #338026 Q35(28.56)$ 12/05/2017 65025 FOOD GENERAL ASSISTANCE CLIENT BENEFIT DAY, HOLIDAYHEALTHAMERICAN SOCIAL HEALTH229.45$ 12/22/2017 62646 IL HIV SURVEILLANCE GRANT STD BROCHURESHEALTHTOTAL ACCESS GROUP198.55$ 12/22/2017 62646 IL HIV SURVEILLANCE GRANT BROCHURES ON PREVENTING STDHEALTHVALLI PRODUCE750.00$ 12/27/2017 64567 PERSONAL EXPENSE GA CLIENT GENERAL ASSISTANCE CLIENTSHEALTHVALLI PRODUCE855.00$ 12/27/2017 64567 PERSONAL EXPENSE GA CLIENT GENERAL ASSISTANCE CLIENTSLAW/LEGALARDC393.47$ 12/01/2017 62360 MEMBERSHIP DUES MEMBERSHIP DUESLAW/LEGALWABASH RANDOLPH GARAGE16.00$ 12/01/2017 62130 LITIGATION PARKING FEE FOR COURTLAW/LEGALLAZ PARKING 60040534.00$ 12/04/2017 62130 LITIGATION PARKING FEE FOR ALBION PLAN DEVELOPMENT MEETINGLAW/LEGALUS COURTS.COM3.95$ 12/07/2017 62345 COURT COSTS/LITIGATION CAUDILL V. COE FILING FEELAW/LEGALUS COURTS.COM3.95$ 12/07/2017 62345 COURT COSTS/LITIGATION CAUDILL V. COE FILING FEELAW/LEGALWABASH RANDOLPH GARAGE17.00$ 12/11/2017 62345 COURT COSTS/LITIGATION PARKING FOR COURTLAW/LEGALWABASH RANDOLPH GARAGE17.00$ 12/11/2017 62345 COURT COSTS/LITIGATION PARKING FOR COURTLAW/LEGALSPOTHERO 844-324-776819.00$ 12/12/2017 62345 COURT COSTS/LITIGATION PARKING FOR COURTLAW/LEGALUS COURTS.COM3.95$ 12/13/2017 62345 COURT COSTS/LITIGATION CALDWELL V. COE - FILING FEELAW/LEGALVENTRA MOBILE20.00$ 12/14/2017 62345 COURT COSTS/LITIGATION TRAIN PAYMENT FOR COURTLAW/LEGALUS COURTS.COM3.95$ 12/18/2017 62345 COURT COSTS/LITIGATION FRIEDMAN V. COELAW/LEGALCOOK CO FIRST MUNICIPA55.13$ 12/19/2017 62345 COURT COSTS/LITIGATION SPECIAL ASSESSMENT FOR KATHY BROWNLAW/LEGALVCN COOKCORODCTR153.15$ 12/19/2017 62345 COURT COSTS/LITIGATION NOTICE TO REMEDIATELAW/LEGALCLB IL PARALEGAL ASSOC75.00$ 12/20/2017 62360 MEMBERSHIP DUES THERESA'S MEMBERSHIP DUESLAW/LEGALDALEYCTRTRAFFIC CTR VC30.63$ 12/20/2017 62345 COURT COSTS/LITIGATION SPECIAL ASSESSMENT FOR KATHY BROWNLAW/LEGALACCO BRANDS DIRECT53.01$ 12/21/2017 65095 OFFICE SUPPLIES 2018 LAW DEPT SCHEDULE BOOKLAW/LEGALUS COURTS.COM3.95$ 12/21/2017 62345 COURT COSTS/LITIGATION COE V. VILLAGE OF SKOKIELAW/LEGALLBP LAW BULLETIN PUBL65.00$ 12/22/2017 65010 BOOKS, PUBLICATIONS, MAPS LAW BULLETIN PUBLISHINGLAW/LEGALTST VIET NOM NOM-133.33$ 12/22/2017 65025 FOOD LAW DEPT LUNCH - EMPLOYEE APPRECIATION FUNDSPOLICE DEPT/ADMINSAMS CLUB #6444512.86$ 12/04/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINSAMS CLUB #644412.72$ 12/04/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINUBER TRIP THNVM41.93$ 12/04/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINUS FLEET TRACKING149.80$ 12/04/2017 41420 RESERVE NARCOTIC ENFORCEMENT TRAINING AND TRAVELPOLICE DEPT/ADMINPANERA BREAD #60064575.70$ 12/07/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINUBER TRIP 7GLTR24.64$ 12/07/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINUOFL SPI(575.00)$ 12/07/2017 62295 TRAINING & TRAVEL REFUND FOR TRAINING SEMINAR AT THE SOUTHERN POLICE INSTITUTE - MANAGING THE MEDIA IN LAW ENFORCEMENTPOLICE DEPT/ADMINUBER TRIP PBLJE5.00$ 12/08/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINSAMS CLUB #6444139.60$ 12/11/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINABM PARKING NU MEM-HUR47.00$ 12/12/2017 62295 TRAINING & TRAVEL PARKING FOR CONFERENCE OF BIG TEN CHIEFSPOLICE DEPT/ADMINLOGISTYX TECHNOLOGIES540.22$ 12/14/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINTHE HOME DEPOT #190216.66$ 12/14/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINSAMSCLUB #644436.10$ 12/15/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINQGV NATIONAL INFORMAT84.00$ 12/18/2017 62360 MEMBERSHIP DUES 2018 NIOA (NATIONAL INFORMATION OFFICER ASSOCIATION) ANNUAL MEMBERSHIPPOLICE DEPT/ADMINTHE HOME DEPOT 190236.91$ 12/18/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINTHE HOME DEPOT 190247.60$ 12/18/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMININTOXIMETERS INC90.05$ 12/21/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINALICE TRAINING INSTITU595.00$ 12/26/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPRCS/CHAND NEWB CNTRARC SERVICES/TRAINING40.00$ 12/04/2017 65110 REC PROGRAM SUPPLIES REGISTRATION FOR ARC CLASS CERTIFICATIONPRCS/CHAND NEWB CNTRMICHAELS STORES 38498.07$ 12/05/2017 65110 REC PROGRAM SUPPLIES PINS AND POM POMS FOR PROGRAM ART PROJECTPRCS/CHAND NEWB CNTRTARGET 0000927477.39$ 12/05/2017 65110 REC PROGRAM SUPPLIES TABLE CLOTHS, PAPER TOWELS, PLATES, MARKERS AND PLAY DOUGH FOR PLAY SCHOOL PROGRAMPRCS/CHAND NEWB CNTRBSN SPORT SUPPLY GROUP88.97$ 12/11/2017 65110 REC PROGRAM SUPPLIES VOLLEY BALL SUPPLIESPRCS/COMMUNITY SERVICESJEWEL #348754.20$ 12/04/2017 65025 FOOD MEMORY CAFE' SNACKSPRCS/COMMUNITY SERVICESTHE HOME DEPOT 1902367.44$ 12/07/2017 63095 HANDYMAN PROGRAM SMOKE AND CO DETECTORS - HANDYMAN PROGRAMPRCS/ECOLOGY CTNRDADANT AMERICAN BEE J162.86$ 12/01/2017 65110 REC PROGRAM SUPPLIES BEE PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRHOME SCIENCE TOOLS157.50$ 12/01/2017 65110 REC PROGRAM SUPPLIES STEM KITS TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRNOVANATURAL139.00$ 12/01/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRU.S. PLASTIC CORPORATI26.80$ 12/01/2017 65110 REC PROGRAM SUPPLIES PUPPET STAND TO BE REIMBURSED BY EEAPRCS/ECOLOGY CTNRVALLI PRODUCE3.78$ 12/01/2017 65110 REC PROGRAM SUPPLIES HONEY SUPPLIESPRCS/ECOLOGY CTNRDIMENSIONS EDUCATIONAL161.00$ 12/04/2017 65110 REC PROGRAM SUPPLIES NATURE PLAYGROUND SUPPLIES TO BE REIMBURSED BY THE EEAFebruary 12, 2018Page 6 of 1165 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPRCS/ECOLOGY CTNRMENARDS E-COMMERCE213.86$ 12/04/2017 65110 REC PROGRAM SUPPLIES NATURE PLAYGROUND FENCING TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNROFFICESUPERSAVERS.COM13.87$ 12/05/2017 65110 REC PROGRAM SUPPLIES HONEY LABELSPRCS/ECOLOGY CTNRSPORTSMANS GUIDE136.86$ 12/08/2017 65110 REC PROGRAM SUPPLIES CANOE CUSHIONS TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRVALLI PRODUCE6.75$ 12/08/2017 62490 OTHER PROGRAM COSTS ANIMAL CARE SUPPLIESPRCS/ECOLOGY CTNRJC LICHT - 1252 - EVAN34.66$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL BREAK ROOM PAINTPRCS/ECOLOGY CTNRGOODWILL RETAIL #16112.95$ 12/12/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIESPRCS/ECOLOGY CTNRPETSMART # 042751.25$ 12/12/2017 62490 OTHER PROGRAM COSTS ANIMAL CARE SUPPLIESPRCS/ECOLOGY CTNRTHE HOME DEPOT 190220.87$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL BUILDING SUPPILIESPRCS/ECOLOGY CTNRPETSMART # 042722.98$ 12/14/2017 62490 OTHER PROGRAM COSTS ANIMAL CAREPRCS/ECOLOGY CTNRVALLI PRODUCE3.33$ 12/14/2017 62490 OTHER PROGRAM COSTS ANIMAL FOODPRCS/ECOLOGY CTNRWALGREENS #261915.28$ 12/14/2017 65110 REC PROGRAM SUPPLIES BREAK ROOM PICTURESPRCS/ECOLOGY CTNRTHE HOME DEPOT #19028.25$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL BUILDING SUPPLIESPRCS/ECOLOGY CTNRLINDEMANN CHIMNEY CO.289.00$ 12/19/2017 62509 SERVICE AGREEMENTS/CONTRACTS CHIMNEY CLEANINGPRCS/ECOLOGY CTNRVALLI PRODUCE3.27$ 12/19/2017 62490 OTHER PROGRAM COSTS ANIMAL CARE SUPPLIESPRCS/ECOLOGY CTNRGFS STORE #191572.56$ 12/20/2017 65025 FOOD WINTER BREAK CAMP SNACKPRCS/ECOLOGY CTNRLLLREPTILE AND SUPPLY46.94$ 12/20/2017 62490 OTHER PROGRAM COSTS ANIMAL CARE FOODPRCS/ECOLOGY CTNRDOLLARTREE2.20$ 12/26/2017 65110 REC PROGRAM SUPPLIES WINTER CAMP SUPPILIESPRCS/ECOLOGY CTNRPETSMART # 042764.75$ 12/26/2017 62490 OTHER PROGRAM COSTS ANIMAL CAREPRCS/ECOLOGY CTNRVALLI PRODUCE3.47$ 12/26/2017 62490 OTHER PROGRAM COSTS ANIMAL FOOD (23.56%)PRCS/ECOLOGY CTNRVALLI PRODUCE11.26$ 12/26/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP SUPPILIES (76.44%)PRCS/ECOLOGY CTNRGFS STORE #191544.48$ 12/28/2017 65025 FOOD WINTER BREAK CAMP FOODPRCS/ECOLOGY CTNRFMNH - FIELD MUSEUM65.00$ 12/29/2017 62507 FIELD TRIPS WINTER BREAK CAMP FIELD TRIPPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN57.83$ 12/01/2017 65025 FOOD FJCC SUPPER ITEMSPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN15.49$ 12/01/2017 65025 FOOD MASON PARK MILKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN22.95$ 12/04/2017 65025 FOOD FJCC SUPPERPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN10.98$ 12/04/2017 65025 FOOD FJCC SUPPERPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN7.98$ 12/04/2017 65025 FOOD SENIOR BINGOPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN267.03$ 12/04/2017 65025 FOOD SENIOR BINGOPRCS/FLEETWOOD JOUR CNTR DOLLARTREE33.00$ 12/05/2017 65110 REC PROGRAM SUPPLIES SENIOR BINGO ITEMSPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN104.03$ 12/06/2017 65025 FOOD FJCC MILKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN260.78$ 12/06/2017 65025 FOOD FJCC SUPPER AND SNACKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN59.76$ 12/06/2017 65025 FOOD RCC MILKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN80.88$ 12/06/2017 65025 FOOD RCC SNACKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN793.53$ 12/07/2017 65025 FOOD FJCC SNACK AND SUPPER SUPPLIESPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN36.77$ 12/07/2017 65025 FOOD FJCC SUPPER ITEMSPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN1,028.40$ 12/07/2017 65025 FOOD FJCC SUPPER ITEMSPRCS/FLEETWOOD JOUR CNTR WALGREENS #26193.79$ 12/07/2017 65025 FOOD SUPPER CONDIMENTSPRCS/FLEETWOOD JOUR CNTR NICKEL CITY184.00$ 12/08/2017 62507 FIELD TRIPS 1/2 DAY TRIPPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN49.54$ 12/11/2017 65025 FOOD FJCC MILKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN115.25$ 12/11/2017 65025 FOOD FJCC SUPPERPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN56.81$ 12/11/2017 65110 REC PROGRAM SUPPLIES MIDDLE SCHOOL PARTY ITEMSPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN202.90$ 12/11/2017 65025 FOOD YMCA BREAKFASTPRCS/FLEETWOOD JOUR CNTR BENNISONS BAKERY INC226.22$ 12/13/2017 62996 HOLIDAY FOOD DRIVE HOLIDAY TOY DRIVE BREAKFASTPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN151.02$ 12/13/2017 65025 FOOD FJCC SUPPERPRCS/FLEETWOOD JOUR CNTR JEWEL.COM #3426214.41$ 12/15/2017 62996 HOLIDAY FOOD DRIVE ITEMS FOR HOLIDAY DRIVEPRCS/FLEETWOOD JOUR CNTR WAL-MART #372575.60$ 12/15/2017 62996 HOLIDAY FOOD DRIVE FOOD FOR MAYOR'S HOLIDAY DRIVEPRCS/FLEETWOOD JOUR CNTR GFS STORE #1915999.99$ 12/18/2017 62996 HOLIDAY FOOD DRIVE TURKEYS FOR MAYOR'S FOOD AND TOY DRIVEPRCS/FLEETWOOD JOUR CNTR GIORDANOS OF EVANSTON278.10$ 12/18/2017 65025 FOOD LUNCH FOR MAYOR'S FOOD & TOY DRIVE.PRCS/FLEETWOOD JOUR CNTR PAPA JOHN'S #01012232.50$ 12/18/2017 65025 FOOD DINNER FOR AFTER SCHOOL PROGRAM.PRCS/FLEETWOOD JOUR CNTR PARTY CITY50.78$ 12/18/2017 65110 REC PROGRAM SUPPLIES HOLIDAY DECORATIONSPRCS/FLEETWOOD JOUR CNTR THE HOME DEPOT 190266.97$ 12/18/2017 65040 JANITORIAL SUPPLIES FLOOR FINISHPRCS/FLEETWOOD JOUR CNTR U-HAUL-EVANSTON #7587655.54$ 12/18/2017 62375 RENTALS TRUCK FOR TURKEY STORAGE. MAYOR'S FOOD & TOY DRIVE.PRCS/FLEETWOOD JOUR CNTR MUSIC THEATER WORKS140.00$ 12/22/2017 62507 FIELD TRIPS WINTER BREAK TRIPPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN106.53$ 12/27/2017 65025 FOOD FJCC MILKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN156.25$ 12/27/2017 65025 FOOD FJCC SNACKPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN9.98$ 12/27/2017 65025 FOOD SUPPER ITEMSPRCS/FLEETWOOD JOUR CNTR RITE LOCK & SAFE9.00$ 12/27/2017 65110 REC PROGRAM SUPPLIES GATE KEYSPRCS/FLEETWOOD JOUR CNTR ENCHANTED CASTLE - IL203.15$ 12/29/2017 62507 FIELD TRIPS WINTER BREAK TRIPPRCS/FLEETWOOD JOUR CNTR GORDON FOOD SERVICE IN24.39$ 12/29/2017 65025 FOOD FJCC SUPPER ITEMPRCS/FLEETWOOD JOUR CNTR NAVY PIER EVENTS & RID650.00$ 12/29/2017 62507 FIELD TRIPS WINTER BREAK TRIPPRCS/FLEETWOOD JOUR CNTR RITE LOCK & SAFE10.50$ 12/29/2017 65110 REC PROGRAM SUPPLIES GATE AND BUS KEYSPRCS/GIBBS CTROFFICE DEPOT #51067.24$ 12/08/2017 65095 OFFICE SUPPLIES OFFICE SUPPLIESPRCS/GIBBS CTRDOLLARTREE7.00$ 12/19/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES FOR OUR WINTER FEST PROGRAM.PRCS/GIBBS CTRFOOD4LESS #055877.99$ 12/20/2017 62490 OTHER PROGRAM COSTS PROGRAMMING SUPPLIES FOR WINTER FESTPRCS/GIBBS CTR9175 DOMINOS PIZZA70.63$ 12/21/2017 65025 FOOD FOOD FOR WINTER FESTFebruary 12, 2018Page 7 of 1166 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPRCS/LEVY SEN CNTRGFS STORE #1915188.61$ 12/04/2017 65025 FOOD KITCHEN SUPPLIES - $50.71 REIMBURSED BY THE LEVY SENIOR CENTER FOUNDATION FOR THE HOLIDAY BREAKFASTPRCS/LEVY SEN CNTRPARTY CITY142.03$ 12/04/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR SENIOR HOLIDAY BREAKFAST - REIMBURSED BY LEVY SENIOR CENTER FOUNDATIONPRCS/LEVY SEN CNTRIDEAL CHARTER MGMT237.50$ 12/06/2017 62507 FIELD TRIPS BUS FOR SENIOR TRIPPRCS/LEVY SEN CNTRUNOCHICAGOGRILL#768314.85$ 12/07/2017 62507 FIELD TRIPS LUNCH FOR SENIOR TRIPPRCS/LEVY SEN CNTRGFS STORE #19155.98$ 12/11/2017 65025 FOOD POPCORN FOR SENIOR PROGRAMPRCS/LEVY SEN CNTRTHE HOME DEPOT #1902140.90$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL BUILDING MAINTENANCEPRCS/LEVY SEN CNTRCLASSICAL GLASS426.24$ 12/18/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR SENIOR GLASS FUSION CLASSESPRCS/LEVY SEN CNTRPANERA BREAD #600645381.59$ 12/20/2017 62507 FIELD TRIPS DINNER FOR SENIOR TRIP - REIMBURSED BY THE LEVY SENIOR CENTER FOUNDATIONPRCS/LEVY SEN CNTRGFS STORE #191511.78$ 12/21/2017 65025 FOOD KITCHEN SUPPLIES - DESSERT FOR SENIOR PROGRAMPRCS/LEVY SEN CNTRIPRA269.00$ 12/28/2017 62360 MEMBERSHIP DUES IPRA MEMBERSHIPPRCS/NOYES CNTRFACEBK H8W2ADNU823.35$ 12/01/2017 65110 REC PROGRAM SUPPLIES FACEBOOK BOOSTPRCS/NOYES CNTRDOLLARTREE12.00$ 12/04/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR POP UP STICK PLAYGROUNDPRCS/NOYES CNTRWALGREENS #26197.56$ 12/04/2017 65110 REC PROGRAM SUPPLIES EARLY CHILDHOOD ARTS SUPPLIESPRCS/NOYES CNTRDOLLARTREE25.00$ 12/06/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE PROPSPRCS/NOYES CNTRGOODWILL RETAIL #1619.97$ 12/06/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE COSTUMESPRCS/NOYES CNTRVALLI PRODUCE18.78$ 12/06/2017 65025 FOOD FOOD FOR FLEETWOOD THEATRE SEASON ANNOUNCEMENT PARTYPRCS/NOYES CNTRBLICK ART 800 447 189212.15$ 12/11/2017 65095 OFFICE SUPPLIES TABLE EASELPRCS/NOYES CNTRGRAND STAGE LIGHTING144.50$ 12/11/2017 65110 REC PROGRAM SUPPLIES LIGHT BOARD REPLACEMENT PART EVANSTON CHILDRENS THEATREPRCS/NOYES CNTRBLICK ART 800 447 18925.50$ 12/13/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE PROPSPRCS/NOYES CNTRCOST PLUS WLD #14717.76$ 12/13/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE PROPSPRCS/NOYES CNTRFOOD4LESS #055847.78$ 12/14/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP SUPPLIESPRCS/NOYES CNTRLEMOI ACE HARDWARE14.37$ 12/14/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE SET SUPPLIESPRCS/NOYES CNTR9175 DOMINOS PIZZA15.98$ 12/15/2017 65025 FOOD FOOD FOR THEATRE CAST AND CREWPRCS/NOYES CNTRVOGUE FABRICS INC6.57$ 12/15/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE SUPPLIESPRCS/NOYES CNTRANTONS GREENHOUSES AND16.00$ 12/18/2017 65110 REC PROGRAM SUPPLIES POP UP STICK PLAYGROUND HAY BALESPRCS/NOYES CNTRDD/BR #338026 Q355.38$ 12/18/2017 65025 FOOD FLEETWOOD THEATRE PROPPRCS/NOYES CNTRFOOD4LESS #055820.53$ 12/18/2017 65025 FOOD FOOD FOR THEATER PRODUCTION OPENING NIGHTPRCS/NOYES CNTRVALLI PRODUCE2.99$ 12/18/2017 65025 FOOD THEATRE PRODUCTION PROPSPRCS/NOYES CNTRKENS CLEANERS18.25$ 12/26/2017 65110 REC PROGRAM SUPPLIES FLEETWOOD THEATRE COSTUME DRY CLEANINGPRCS/NOYES CNTRD AND D FINER FOODS8.27$ 12/27/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP SUPPLIESPRCS/RBT CROWN CNTRALDI 4006815.33$ 12/01/2017 65025 FOOD MILK FOR PRESCHOOLPRCS/RBT CROWN CNTRDOLLARTREE35.00$ 12/01/2017 65110 REC PROGRAM SUPPLIES PROPS FOR HOLIDAY SHOWPRCS/RBT CROWN CNTROTC BRANDS, INC.302.71$ 12/01/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR WINTER BREAK CAMPPRCS/RBT CROWN CNTRDANSCO166.47$ 12/04/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER COSTUMESPRCS/RBT CROWN CNTRGFS STORE #1915392.79$ 12/04/2017 65025 FOOD GROCERIES FOR PRESCHOOL SNACKSPRCS/RBT CROWN CNTROTC BRANDS, INC.16.92$ 12/04/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR HOLIDAY CRAFTSPRCS/RBT CROWN CNTRTHEATREWORLD BACKDROPS1,200.64$ 12/04/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER BACKDROPS/CURTAINSPRCS/RBT CROWN CNTRVOGUE FABRICS INC47.92$ 12/04/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER FABRIC FOR SHOWPRCS/RBT CROWN CNTR838 - BRUNSWICK ZONE -153.78$ 12/06/2017 62507 FIELD TRIPS FIELD TRIP FOR AFTER SCHOOL ADVENTURE FULL DAYPRCS/RBT CROWN CNTRCURTAIN CALL COSTUMES294.89$ 12/07/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER COSTUMESPRCS/RBT CROWN CNTR838 - BRUNSWICK ZONE -27.96$ 12/08/2017 62507 FIELD TRIPS FIELD TRIP FOR AFTER SCHOOL ADVENTURE FULL DAYPRCS/RBT CROWN CNTRFOOD4LESS #055856.04$ 12/08/2017 65110 REC PROGRAM SUPPLIES FOOD FOR PRESCHOOL PROGRAMPRCS/RBT CROWN CNTROLIVE GARDEN 00012914187.35$ 12/08/2017 65025 FOOD LUNCH FOR AFTER SCHOOL ADVENTURE FULL DAYPRCS/RBT CROWN CNTRUS FIGURE SKATING50.00$ 12/08/2017 65110 REC PROGRAM SUPPLIES FEE FOR FIGURE SKATING PROGRAMPRCS/RBT CROWN CNTRJEWEL #348722.92$ 12/12/2017 65025 FOOD MILK FOR PRESCHOOLPRCS/RBT CROWN CNTRLITTLE CAESARS 1257 0018.00$ 12/12/2017 65025 FOOD PIZZA PARTY FOR DUAL ENROLLMENTPRCS/RBT CROWN CNTRMICHAELS STORES 384962.85$ 12/13/2017 65110 REC PROGRAM SUPPLIES HOLIDAY CRAFT SUPPLIESPRCS/RBT CROWN CNTRSARPINOS PIZZA OF EVAN71.00$ 12/14/2017 65110 REC PROGRAM SUPPLIES LUNCH FOR MAINTENANCE FOR NUTCRACKER SET UPPRCS/RBT CROWN CNTRWALGREENS #421844.24$ 12/14/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER SUPPLIESPRCS/RBT CROWN CNTRPARTY CITY59.98$ 12/15/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER SUPPLIESPRCS/RBT CROWN CNTRPURE ELECTRIC23.94$ 12/15/2017 62490 OTHER PROGRAM COSTS ELECTRICAL SUPPLIESPRCS/RBT CROWN CNTRVOGUE FABRICS INC38.37$ 12/15/2017 65110 REC PROGRAM SUPPLIES FABRIC FOR NUTCRACKERPRCS/RBT CROWN CNTRALLEGRO DANCE BOUTI72.99$ 12/18/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER EXPENSEPRCS/RBT CROWN CNTRDOLLARTREE41.00$ 12/18/2017 65110 REC PROGRAM SUPPLIES DECOR FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRGFS STORE #1915454.60$ 12/18/2017 65025 FOOD SNACKS FOR PRESCHOOLPRCS/RBT CROWN CNTRIPRA254.00$ 12/18/2017 62360 MEMBERSHIP DUES ILLINOIS PARKS AND RECREATION ASSOCIATION MEMBERSHIPPRCS/RBT CROWN CNTRLEARN TO SKATE USA33.50$ 12/18/2017 62360 MEMBERSHIP DUES LEARN TO SKATE MEMBERSHIPPRCS/RBT CROWN CNTRREVDANCE/TENTH HOUSE99.98$ 12/18/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER EXPENSEPRCS/RBT CROWN CNTRSARI SAPNE INC20.00$ 12/18/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER EXPENSEPRCS/RBT CROWN CNTRTHE HOME DEPOT #190273.13$ 12/18/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR MAINTENANCEPRCS/RBT CROWN CNTRUMA SAREES25.00$ 12/18/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER EXPENSEPRCS/RBT CROWN CNTRFOOD4LESS #055867.77$ 12/20/2017 65025 FOOD CANDY FOR GINGERBREAD HOUSE WORKSHOPPRCS/RBT CROWN CNTRDOLLARTREE43.00$ 12/21/2017 65110 REC PROGRAM SUPPLIES DECOR FOR HOLIDAY SHOWFebruary 12, 2018Page 8 of 1167 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPRCS/RBT CROWN CNTRGFS STORE #1915184.04$ 12/21/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRLITTLE CAESARS 1257 00161.00$ 12/21/2017 65025 FOOD DINNER FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRBB CHICAGO BOTANIC113.00$ 12/22/2017 62507 FIELD TRIPS FIELD TRIP FOR WINTER BREAK CAMPPRCS/RBT CROWN CNTRDOLLARTREE18.00$ 12/22/2017 65110 REC PROGRAM SUPPLIES BAGS FOR HOLIDAY RAFFLESPRCS/RBT CROWN CNTRDOLLARTREE37.00$ 12/22/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRPAYPAL KRPHOTOGS816.00$ 12/22/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER PHOTOSPRCS/RBT CROWN CNTRLITTLE CAESARS 1257 0023.00$ 12/26/2017 65025 FOOD DINNER FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRLITTLE CAESARS 1257 0048.00$ 12/26/2017 65025 FOOD DINNER FOR HOLIDAY SHOWPRCS/RBT CROWN CNTRPAYPAL KRPHOTOGS680.00$ 12/26/2017 65110 REC PROGRAM SUPPLIES NUTCRACKER PHOTOSPRCS/RBT CROWN CNTRNATURE CREATURES250.00$ 12/27/2017 62507 FIELD TRIPS IN HOUSE FIELD TRIP FOR WINTER BREAK CAMPPRCS/RBT CROWN CNTRCLASSIC BOWL99.75$ 12/29/2017 62507 FIELD TRIPS FIELD TRIP FOR WINTER BREAK CAMPPRCS/RECREATIONCHURCH STREET SELF PAR3.00$ 12/04/2017 62490 OTHER PROGRAM COSTS PARKING METER FEE FOR ANNUALL ECONOMIC DEVELOPMENT MEETINGPRCS/RECREATIONSMK WUFOO.COM CHARGE39.00$ 12/04/2017 62490 OTHER PROGRAM COSTS WEBSITE FOR HOLIDAY FOOD AND TOY DRIVEPRCS/RECREATIONCROWN TROPHY 5498.85$ 12/06/2017 62490 OTHER PROGRAM COSTS TROPHIES FOR FALL BROOMBALL LEAGUEPRCS/RECREATIONNCTRC80.00$ 12/08/2017 62360 MEMBERSHIP DUES RECERTIFICATION FOR CTRS MYRA GORMANPRCS/RECREATION22 - LOU MALNATIS PIZZ250.00$ 12/11/2017 65025 FOOD FOOD FOR SPECIAL RECREATION PARTICIPANT HOLIDAY PARTYPRCS/RECREATIONJEWEL #348793.92$ 12/11/2017 65025 FOOD FOOD FOR SPECIAL RECREATION PARTICIPANT HOLIDAY PARTYPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/15/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONIPRA254.00$ 12/15/2017 62360 MEMBERSHIP DUES IL PARKS AND RECREATION ASSOCIATION MEMBERSHIP FEEPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/18/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/18/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/18/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONGFS STORE #1915975.71$ 12/18/2017 62996 HOLIDAY FOOD DRIVE FOOD PURCHASE FOR MAYOR HAGERTY TOY AND FOOD DRIVEPRCS/RECREATIONGFS STORE #19154,580.15$ 12/18/2017 62996 HOLIDAY FOOD DRIVE TURKEYS PURCHASED FOR MAYOR'S HOLIDAY FOOD/TOY GIVEAWAYPRCS/RECREATIONCVS/PHARMACY #087608.99$ 12/19/2017 65125 OTHER COMMODITIES PRCS HALLOWEEN AWARD LUNCHEONPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/19/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONWHOLEFDS GBR #1057023.95$ 12/19/2017 65125 OTHER COMMODITIES PRCS HALLOWEEN AWARD LUNCHEONPRCS/RECREATION22 - EC - LOU MALNATIS237.35$ 12/21/2017 65125 OTHER COMMODITIES PRCS HALLOWEEN AWARD LUNCHEONPRCS/RECREATIONDENGEOS SKOKIE500.00$ 12/21/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONDENGEOS SKOKIE300.00$ 12/22/2017 22790 EMPLOYEE ADVISORY COMMITTEE COE STAFF LUNCHEONPRCS/RECREATIONEMERGENCY MEDICAL PROD180.17$ 12/28/2017 65075 MEDICAL & LAB SUPPLIES FIRST AID SUPPLIESPRCS/RECREATIONLEARN TO SKATE USA(16.00)$ 12/29/2017 62360 MEMBERSHIP DUES REFUNDPRCS/RECREATIONLEARN TO SKATE USA(16.00)$ 12/29/2017 62360 MEMBERSHIP DUES REFUNDPRCS/RECREATION ADMINOSAGIAN CANOES2,398.00$ 12/06/2017 65110 REC PROGRAM SUPPLIES 2 CANOES REIMBURSED BY THE EVANSTON ENVIRONMENTAL ASSOCPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL2.35$ 12/04/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTGIGIO S49.40$ 12/05/2017 62490 OTHER PROGRAM COSTS YYA MIDDLE SCHOOL MENTORING GROUPSPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL2.35$ 12/06/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTSMK SURVEYMONKEY.COM29.00$ 12/08/2017 62490 OTHER PROGRAM COSTS MSYEP PARTICIPANT EMPLOYER SURVEYPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL1.85$ 12/11/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL2.35$ 12/11/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL2.35$ 12/13/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTCITY OF EVENSTON2.00$ 12/13/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTCITY OF EVENSTON2.00$ 12/13/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPRCS/YOUTH ENGAGEMENTCITY OF EVANSTON MOBIL2.35$ 12/14/2017 62490 OTHER PROGRAM COSTS OUTREACH PARKINGPUBLIC WORKS AGENCY ADMIN AMERICAN PUBLIC WORKS98.49$ 12/01/2017 62295 TRAINING & TRAVEL APWA SEMINAR: EVERYTHING YOU NEED TO KNOW TO BE A PUBLIC WORKS DIRECTOR.PUBLIC WORKS AGENCY ADMIN HERTZ RENT-A-CAR1,133.16$ 12/04/2017 62375 RENTALS AUTO RENTAL FOR CONSTRUCTION SEASONPUBLIC WORKS AGENCY ADMIN TARGET 00009274100.00$ 12/19/2017 65125 OTHER COMMODITIES EMPLOYEE SAFETY INCENTIVE: TEN $10 GIFT CARD PRIZES FOR THE PWA HOLIDAY SAFETY MEETING/LUNCHEON.PUBLIC WORKS/ENG INFBNP ENR/AR/NEWS/PS43.00$ 12/04/2017 65010 BOOKS, PUBLICATIONS, MAPS ENGINEERING SUBSCRIPTIONPUBLIC WORKS/ENG INFFORESTRY SUPPLIERS INC454.87$ 12/06/2017 65085 MINOR EQUIP & TOOLS ENGINEERING SURVEYING SUPPLIESPUBLIC WORKS/ENG INFBHFX #10777.50$ 12/26/2017 65085 MINOR EQUIP & TOOLS SUPPLIES FOR ENGINEERING PLOTTERPUBLIC WORKS/ENVIR SVCSARLINGTON POWER EQUIPM221.03$ 12/01/2017 65085 MINOR EQUIP & TOOLS BRAKE BAND/HOUR METERPUBLIC WORKS/ENVIR SVCSARLINGTON POWER EQUIPM72.40$ 12/01/2017 65085 MINOR EQUIP & TOOLS SHOVELSPUBLIC WORKS/ENVIR SVCSEVANSTON LUMBER60.80$ 12/04/2017 62199 PRK MAINTENANCE & FURNITUR REPLACE FLEETWOOD FENCINGPUBLIC WORKS/ENVIR SVCSAMERICAN SWING PRODUCT45.00$ 12/07/2017 62199 PRK MAINTENANCE & FURNITUR REPLACE SWING CHAINPUBLIC WORKS/ENVIR SVCSBUMPER TO BUMPER EVANS51.37$ 12/07/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL FILTERSPUBLIC WORKS/ENVIR SVCSUSPS PO 16262202026.59$ 12/08/2017 62315 POSTAGE CERTIFIED MAILPUBLIC WORKS/ENVIR SVCSGAMETIME1,019.83$ 12/11/2017 65625 FURNITURES AND FIXTURES LAWSON PARK SLIDEPUBLIC WORKS/ENVIR SVCSSTO-COTE PRODUCTS631.13$ 12/11/2017 62199 PRK MAINTENANCE & FURNITUR REPLACE ICE RINK LINERPUBLIC WORKS/ENVIR SVCSTHE HOME DEPOT 190283.88$ 12/11/2017 62199 PRK MAINTENANCE & FURNITUR REPLACE ARBORETUM FENCEPUBLIC WORKS/ENVIR SVCSSTO-COTE PRODUCTS297.60$ 12/14/2017 62199 PRK MAINTENANCE & FURNITUR REPLACE ICE RINK CAPSPUBLIC WORKS/ENVIR SVCSTHE HOME DEPOT #1902576.97$ 12/15/2017 65085 MINOR EQUIP & TOOLS HAMMER DRILLPUBLIC WORKS/ENVIR SVCSSHERRILLTRE36.37$ 12/29/2017 65085 MINOR EQUIP & TOOLS SAFETY HELMET REPLACEMENT PARTSPUBLIC WORKS/OPER MAINCONNEXION780.00$ 12/01/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STREET LIGHT BALLAST KITSPUBLIC WORKS/OPER MAINAGRIMART155.37$ 12/04/2017 65625 FURNITURES AND FIXTURES MATERIALS FOR BRINE MAKERFebruary 12, 2018Page 9 of 1168 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPUBLIC WORKS/OPER MAINTAPCO605.00$ 12/04/2017 65115 TRAFFIC CONTROL SUPPLIES SURFACE MOUNT ANCHOR FOR SIGN POSTSPUBLIC WORKS/OPER MAINOFFICE DEPOT #51061.93$ 12/06/2017 65085 MINOR EQUIPMENT AND TOOLS OFFICE SUPPLIESPUBLIC WORKS/OPER MAINTHE HOME DEPOT 190229.94$ 12/07/2017 65085 MINOR EQUIPMENT AND TOOLS CLEAR 55 GALLON BAGS FOR COLLECTIVE RESOURCES PLASTIC FILM COLLECTIONPUBLIC WORKS/OPER MAINCONNEXION730.96$ 12/08/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL MULTIMETER AND FUSESPUBLIC WORKS/OPER MAINTHE UPS STORE #051122.69$ 12/08/2017 65085 MINOR EQUIP & TOOLS SHIPPING COSTS TO SEND CONTROLLER FOR REPAIRSPUBLIC WORKS/OPER MAINUSPS PO 162622020213.18$ 12/08/2017 62315 POSTAGE LETTER TO RESIDENT FOR SANITATION SERVICE FEESPUBLIC WORKS/OPER MAINTHE HOME DEPOT 190215.97$ 12/11/2017 65085 MINOR EQUIP & TOOLS POWER EXTENSION CORD FOR TRASH TRUCK (ENGINE BLOCK HEATER)PUBLIC WORKS/OPER MAINOFFICE DEPOT #510216.62$ 12/14/2017 65115 TRAFFIC CONTROL SUPPLIES OFFICE SUPPLIESPUBLIC WORKS/OPER MAINCONNEXION523.63$ 12/15/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SPLIT BOLTSPUBLIC WORKS/OPER MAINTHE HOME DEPOT #190218.25$ 12/18/2017 65085 MINOR EQUIP & TOOLS BARRICADE BOARDPUBLIC WORKS/OPER MAINTRAFFIC CONTROL AND PR980.00$ 12/18/2017 65115 TRAFFIC CONTROL SUPPLIES IN STREET STOP FOR PEDESTRIAN SIGNSPUBLIC WORKS/OPER MAINOFFICE DEPOT #5107.99$ 12/19/2017 65085 MINOR EQUIP & TOOLS OFFICE SUPPLIESPUBLIC WORKS/OPER MAINCONNEXION975.00$ 12/22/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WIRE SPLICE CONNECTORS AND CRIMP TOOLPUBLIC WORKS/OPER MAINIDEAL CLAMP PRODUCT1,262.64$ 12/22/2017 65115 TRAFFIC CONTROL SUPPLIES SIGN MOUNTS STRAPPINGPUBLIC WORKS/OPER MAINIHOP #120397.67$ 12/26/2017 62295 TRAINING & TRAVEL SAFETY HOLIDAY BREAKFASTPUBLIC WORKS/OPER MAINLEMOI ACE HARDWARE50.97$ 12/29/2017 65085 MINOR EQUIP & TOOLS BATTERIESPUBLIC WORKS/OPER MAINOFFICE DEPOT #51073.37$ 12/29/2017 65115 TRAFFIC CONTROL SUPPLIES OFFICE SUPPLIESPUBLIC WORKS/OPER MAINUSPS PO 16262202043.43$ 12/29/2017 62315 POSTAGE LETTER TO RESIDENT FOR SANITATION SERVICE FEESPUBLIC WORKS/WATER PRODDIESELFILTERSONLINE910.84$ 12/01/2017 65035 PETROLEUM PRODUCTS CRANKCASE VENT ELEMENTS.PUBLIC WORKS/WATER PRODMCMASTER-CARR42.97$ 12/01/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STAINLESS GREASE ZERKS.PUBLIC WORKS/WATER PRODMCMASTER-CARR36.42$ 12/01/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STAINLESS STEEL SCREWS.PUBLIC WORKS/WATER PRODWW GRAINGER171.50$ 12/01/2017 65035 PETROLEUM PRODUCTS CHAIN AND GEAR LUBE, AND RAGS.PUBLIC WORKS/WATER PRODWW GRAINGER64.54$ 12/01/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SHOP RAGS.PUBLIC WORKS/WATER PRODGIH GLOBALINDUSTRIALEQ100.94$ 12/04/2017 65090 SAFETY EQUIPMENT HAZMAT BOOTS.PUBLIC WORKS/WATER PRODDWYER INSTRUMENTS INC530.87$ 12/05/2017 65085 MINOR EQUIP & TOOLS POSITION INDICATOR.PUBLIC WORKS/WATER PRODINTERSTATE ALL BATTERY141.00$ 12/05/2017 65090 SAFETY EQUIPMENT BATTERIES FOR ARROW BOARD.PUBLIC WORKS/WATER PRODJEWELERS SHIPPING602.55$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL METAL STOCK.PUBLIC WORKS/WATER PRODPATTEN1,069.03$ 12/05/2017 65035 PETROLEUM PRODUCTS OIL ANALYSIS KITS, AND BATTERIES.PUBLIC WORKS/WATER PRODSECURITY EQUIPMENT SUP3,648.30$ 12/05/2017 65515 OTHER IMPROVEMENTS SECURITY - SLIDE GATE OPERATOR.PUBLIC WORKS/WATER PRODALLIED ELECTRONICS INC88.52$ 12/06/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL ELECTRICAL SWITCH BLOCK.PUBLIC WORKS/WATER PRODSUPPLYHOUSE.COM12.75$ 12/06/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL GALVANIZED PIPE NIPPLES.PUBLIC WORKS/WATER PRODB&B ELECTRONICS LTD(62.93)$ 12/07/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SALES TAX REFUND.PUBLIC WORKS/WATER PRODULINE SHIP SUPPLIES219.21$ 12/07/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WALL CABINET.PUBLIC WORKS/WATER PRODABOLOX LLC57.71$ 12/08/2017 65085 MINOR EQUIP & TOOLS SLUGGING WRENCH.PUBLIC WORKS/WATER PRODBUSHNELL INCORPORATED1,361.13$ 12/08/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PVC PIPE FITTINGS.PUBLIC WORKS/WATER PRODUSA BLUE BOOK23.38$ 12/08/2017 65075 MEDICAL & LAB SUPPLIES BROMOTHYMOL BLUE.PUBLIC WORKS/WATER PRODVWR INTERNATIONAL INC135.12$ 12/08/2017 65075 MEDICAL & LAB SUPPLIES TISAB.PUBLIC WORKS/WATER PRODGORDON ELECTRIC SUPPLY79.80$ 12/11/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PLUG RECEPTICLES.PUBLIC WORKS/WATER PRODMOUNTAIN PRODUCTIONS,178.14$ 12/11/2017 65085 MINOR EQUIP & TOOLS CHAIN HOIST.PUBLIC WORKS/WATER PRODVWR INTERNATIONAL INC127.78$ 12/11/2017 65075 MEDICAL & LAB SUPPLIES FLUORIDE STDS.PUBLIC WORKS/WATER PRODVWR INTERNATIONAL INC71.08$ 12/11/2017 65075 MEDICAL & LAB SUPPLIES TSB FOR MICRO QC.PUBLIC WORKS/WATER PRODWW GRAINGER91.32$ 12/11/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL "D" BATTERIES FOR THE SERVICE BUILDING.PUBLIC WORKS/WATER PRODE-CONOLIGHT767.90$ 12/12/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL RETRO FIT LIGHTS FOR THE TRANSFORMER ROOM.PUBLIC WORKS/WATER PRODSIDENER ENVIROMENTAL187.55$ 12/13/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PUMP REBUILD KIT.PUBLIC WORKS/WATER PRODSUPERIOR INDUSTRIAL SP181.72$ 12/13/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PAPER TOWELS AND TOILET PAPER.PUBLIC WORKS/WATER PRODAUTOMATIONDIRECT.COM73.00$ 12/14/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL REPLACEMENT SAFETY SWITCH RADIAL DRILL PRESS.PUBLIC WORKS/WATER PRODTHE HOME DEPOT #190292.79$ 12/14/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL KEROSENE.PUBLIC WORKS/WATER PRODZORO TOOLS INC68.34$ 12/14/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL ALUMINUM TUBING, AND SOUT STANDPIPE RAIN GAUGE THERMOSTAT.PUBLIC WORKS/WATER PRODL-COM,INC48.47$ 12/15/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL RF ADAPTER CABLES.PUBLIC WORKS/WATER PRODMENARDS MORTON GROVE I96.35$ 12/15/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL BOILER ROOM SHELF PARTS, AND WATER SOFTENER SALT.PUBLIC WORKS/WATER PRODPGH WATER COOLER62.35$ 12/15/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WATER FOUNTAIN REPAIR PARTS.PUBLIC WORKS/WATER PRODSUPERIOR INDUSTRIAL SP67.82$ 12/15/2017 65040 JANITORIAL SUPPLIES MULTI-FOLD PAPER TOWELS.PUBLIC WORKS/WATER PRODWW GRAINGER273.51$ 12/15/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL GORMAN RUPP PUMP FLOATS, AND RAIN GAUGE HEATER.PUBLIC WORKS/WATER PRODJACKS SMALL ENGINES &35.95$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL LAWN MOWER ENGINE PARTS.PUBLIC WORKS/WATER PRODJAMECO/JIMPAK ELECTRON42.19$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL MAGNETS, AND HEAT SHRINK TUBING.PUBLIC WORKS/WATER PRODREVERE ELECTRIC SUPPLY1,430.56$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SCADA MODULE BASES.PUBLIC WORKS/WATER PRODREVERE ELECTRIC SUPPLY1,437.89$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SCADA MODULES.PUBLIC WORKS/WATER PRODZORO TOOLS INC54.63$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL GLUE, LINE VOLTAGE THERMOSTAT.PUBLIC WORKS/WATER PRODZORO TOOLS INC156.69$ 12/18/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SAMPLE PUMP MOTOR.PUBLIC WORKS/WATER PRODNOVASPECT HOLDINGS INC1,014.00$ 12/19/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PUMP SEAL PACKING.PUBLIC WORKS/WATER PRODCARDINAL PUMP COMPANY60.00$ 12/20/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PUMP SEALS.PUBLIC WORKS/WATER PRODDWYER INSTRUMENTS, INC16.50$ 12/20/2017 65085 MINOR EQUIP & TOOLS POSITION INDICATOR YOKE.PUBLIC WORKS/WATER PRODLAX ENGINEERED SOLUTIO61.09$ 12/20/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL ELECTRICAL RELAY.PUBLIC WORKS/WATER PRODPETROLEUMSERVICECOMPAN816.43$ 12/20/2017 65035 PETROLEUM PRODUCTS FOOD GRADE GREASE.PUBLIC WORKS/WATER PRODBATTERY MART OF WINCHE177.49$ 12/21/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL BATTERY CHARGER FOR THE MCCORMICK VAULT COMM CABINET.February 12, 2018Page 10 of 1169 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPUBLIC WORKS/WATER PRODE-CONOLIGHT217.53$ 12/21/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL EMERGENCY LIGHTS.PUBLIC WORKS/WATER PRODFASTENAL COMPANY01118.53$ 12/21/2017 65055 MATERIALS TO MAINTAIN IMPROVEMENTS BOLTS FOR 36" HATCHES.PUBLIC WORKS/WATER PRODPLATT ELECTRIC 80054.88$ 12/21/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL CONDUIT BODY COVERS.PUBLIC WORKS/WATER PRODZIEBELL WATER SERVI354.88$ 12/21/2017 65055 MATERIALS TO MAINTAIN IMPROVEMENTS NON-BID BRASS.PUBLIC WORKS/WATER PRODZORO TOOLS INC72.21$ 12/21/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL CORDED PHONES.PUBLIC WORKS/WATER PRODAMERICAN WATER WORKS A36.00$ 12/22/2017 62295 TRAINING & TRAVEL AWWA SEMINAR: SCADA 204, FOR THE WATER/SEWER MECHANIC.PUBLIC WORKS/WATER PRODMCMASTER-CARR22.41$ 12/22/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STAINLESS STEEL SCREWS.PUBLIC WORKS/WATER PRODMETAL SUPERMARKETS1,234.02$ 12/22/2017 65055 MATERIALS TO MAINTAIN IMPROVEMENTS METAL STOCK.PUBLIC WORKS/WATER PRODPANINO'S PIZZERIA OR939.88$ 12/22/2017 68205 PUBLIC WKS CONTINGENCIES SPLIT - HOLIDAY SAFETY MEETING LUNCHEON. (62.33%)PUBLIC WORKS/WATER PRODPANINO'S PIZZERIA OR568.00$ 12/22/2017 65125 OTHER COMMODITIES SPLIT - HOLIDAY SAFETY MEETING/LUNCHEON. (37.67%)PUBLIC WORKS/WATER PRODSWANSON FLO CO1,587.50$ 12/22/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL LIMITORQUE-INSTALLATION OF APT CARDS INTO EXISTING QX ACTUATORS.PUBLIC WORKS/WATER PRODTHE HOME DEPOT #1902377.88$ 12/22/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SHOVELS.PUBLIC WORKS/WATER PRODFULLIFE SAFETY CENTER769.00$ 12/26/2017 65090 SAFETY EQUIPMENT INSULATED WINTER WORK GEAR.PUBLIC WORKS/WATER PRODFULLIFE SAFETY CENTER293.75$ 12/26/2017 65020 CLOTHING RAIN GEAR.PUBLIC WORKS/WATER PRODFULLIFE SAFETY CENTER769.00$ 12/26/2017 65020 CLOTHING REPLACEMENT BIBS.PUBLIC WORKS/WATER PRODMCMASTER-CARR240.10$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STAINLESS STOCK FOR DISTRIBUTION NUTS.PUBLIC WORKS/WATER PRODTHE HOME DEPOT 190237.94$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL BIMETAL HOLE SAW.PUBLIC WORKS/WATER PRODWW GRAINGER308.33$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL METAL SAW BLADES, AND FASTENERS.PUBLIC WORKS/WATER PRODZORO TOOLS INC57.18$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL LAWNMOWER PARTS AND CUTTER BLADE.PUBLIC WORKS/WATER PRODZORO TOOLS INC153.94$ 12/28/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SAMPLE PUMP MOTOR.PUBLIC WORKS/WATER PRODNOR NORTHERN TOOL57.30$ 12/29/2017 65055 MATERIALS TO MAINTAIN IMPROVEMENTS D-RINGS FOR TRAILER.PUBLIC WORKS/WATER PRODWW GRAINGER1,173.56$ 12/29/2017 65040 JANITORIAL SUPPLIES CLEANING SUPPLIES, AND PAPER GOODS.DECEMBER ALL OTHER TOTAL159,115.23$ February 12, 2018Page 11 of 1170 of 549 BMO Harris Bank Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECTEXPENSE DESCRIPTIONCMO/FINANCE ADMINPAYPAL MSF8164 $ 633.17 12/20/201765095 OFFICE SUPPLIESPRINTING FOR RESIDENTIAL PARKING PERMITSADMIN SVCS/FACILITIESSQU*SQ *A-1 EQUIPTMENT $ 1,761.09 12/22/201765085-MINOR EQUIP & TOOLSFLEET TIRE MACHINE REPAIRSDECEMBER STATEMENT TOTAL2,394.26$ February 12, 2018Page 1 of 171 of 549 To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Ashley King Interim Chief Financial Officer Tera Davis, Accounts Payable Coordinator Subject: Amazon Credit Card Activity Date: February 7, 2018 Recommended Action: Staff recommends approval of the City of Evanston’s Amazon Credit Card Activity for the period ending December 31, 2017. Summary: Amazon Credit Card Activity – Period Ending December 31, 2017 $10,571.30 Attachments: Amazon December Credit Card Transactions For City Council meeting of February 12, 2018 Item A2.2 Business of the City by Motion: Amazon Credit Card Activity For Action Memorandum 72 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI197.20$ 12/04/2017 65050 BUILDING MAINTENANCE MATERIAL LIGHTNING DETECTIONADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI80.00$ 12/04/2017 65085 MINOR EQUIP & TOOLS WRENCHES FOR HVAC TEAMADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS7.29$ 12/05/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIALS FOR RETIREMENT PLAQUEADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS22.94$ 12/05/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR DIRECTORY SIGNSADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS49.43$ 12/06/2017 65090 SAFETY EQUIPMENT WET WEATHER GEARADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI294.01$ 12/07/2017 65090 SAFETY EQUIPMENT STAFF PPEADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI239.97$ 12/08/2017 65050 BUILDING MAINTENANCE MATERIAL BOXES FOR ATTIC STORAGEADMIN SVCS/FACILITIESAMAZON.COM WWW.AMAZON.33.48$ 12/08/2017 65095 OFFICE SUPPLIES OFFICE SUPPLIESADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS129.47$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL TRAFFIC BODY CAM STORAGEADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI23.24$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL HOLIDAY LUNCHEON MATERIALSADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI28.88$ 12/11/2017 65050 BUILDING MAINTENANCE MATERIAL SERVICE TRUCK SUPPLIESADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS30.99$ 12/12/2017 65085 MINOR EQUIP & TOOLS TOOLSADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS86.38$ 12/13/2017 65050 BUILDING MAINTENANCE MATERIAL TRAFFIC BODYCAM STORAGEADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI17.27$ 12/14/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR MAYORS OFFICEADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS W4.51$ 12/15/2017 65050 BUILDING MAINTENANCE MATERIAL PARKING SIGN LETTERINGADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS W11.48$ 12/19/2017 65050 BUILDING MAINTENANCE MATERIAL PARKING SIGN LETTERINGADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS W78.89$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL CABLE FEEDADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS W47.19$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL MATERIAL FOR MAYORS OFFICEADMIN SVCS/FACILITIESAMAZON MKTPLACE PMTS W45.26$ 12/26/2017 65085 MINOR EQUIP & TOOLS TOOLS FOR SHOPADMIN SVCS/FACILITIESAMAZON.COM AMZN.COM/BI70.99$ 12/26/2017 65050 BUILDING MAINTENANCE MATERIAL WATER FILTERS FOR FRIDGEADMIN SVCS/FLEETAMAZON MKTPLACE PMTS190.40$ 12/05/2017 65060 MATERIALS TO MAINTAIN AUTOS RATCHET TYPE CHAIN BINDERS AND CHAINADMIN SVCS/FLEETAMAZON.COM AMZN.COM/BI592.92$ 12/11/2017 62375 RENTALS 36 TELESCOPING SNOW BRUSHES FOR PUBLIC WORKS TRUCKSADMIN SVCS/FLEETAMAZON.COM AMZN.COM/BI169.60$ 12/14/2017 65060 MATERIALS TO MAINTAIN AUTOS SNOW BRUSHESADMIN SVCS/FLEETAMAZON.COM AMZN.COM/BI83.34$ 12/19/2017 65060 MATERIALS TO MAINTAIN AUTOS RED HEADLIGHTSADMIN SVCS/HUMAN RESAMAZON MKTPLACE PMTS44.97$ 12/11/2017 65095 OFFICE SUPPLIES OFFICE SUPPLIESADMN SERVICESAMAZON.COM AMZN.COM/BI41.40$ 12/11/2017 66040 GENERAL ADMINISTRATION OFFICE SUPPLIES FOR J. LASIKADMN SVCS/INFO SYSAMAZON MKTPLACE PMTS48.28$ 12/01/2017 62250 COMPUTER EQUIPMENT MAINT. #17223 PROJECTOR REPLACEMENT LAMP FOR RM2600ADMN SVCS/INFO SYSAMAZON MKTPLACE PMTS99.99$ 12/04/2017 64510 TELECOMM EQ (IS) SOUTH END - CAMERA WALL MOUNTADMN SVCS/INFO SYSAMAZON.COM AMZN.COM/BI437.98$ 12/04/2017 62250 COMPUTER EQUIPMENT MAINT. CHROMEBOOK FOR JASON PARROTTADMN SVCS/INFO SYSAMAZON MKTPLACE PMTS W430.95$ 12/11/2017 64510 TELECOMM EQ (IS) CISCO REPLACEMENT AP FOR CHANDLERADMN SVCS/INFO SYSAMAZON MKTPLACE PMTS499.80$ 12/12/2017 65555 PERSONAL COMPUTER EQ #17258 MONITORS FOR CATALOG STATIONS FOR LIBRARYADMN SVCS/INFO SYSAMAZON MKTPLACE PMTS W940.14$ 12/12/2017 64510 TELECOMM EQ (IS) CISCO REPLACEMENT APS FOR LEVYADMN SVCS/INFO SYSAMAZON.COM AMZN.COM/BI29.38$ 12/12/2017 62250 COMPUTER EQUIPMENT MAINT. #17322 LUBRICANT FOR 911 BUTTONS, #17265 HANDSET CORD, LABELS FOR WIRE LABEL MACHINE.ADMN SVCS/INFO SYSAMAZONPRIME MEMBERSHIP99.00$ 12/26/2017 62340 IS SUPPORT FEES AMAZON PRIME SUBSCRIPTIONADMN SVCS/PARKIING SVCSAMAZON MKTPLACE PMTS21.98$ 12/14/2017 65045 LICENSING/REGULATORY SUPPLIES NAME TAGSADMN SVCS/PARKIING SVCSAMAZON MKTPLACE PMTS W653.96$ 12/19/2017 65020 CLOTHING PEO UNIFORMSADMN SVCS/PARKIING SVCSAMAZON MKTPLACE PMTS21.98$ 12/22/2017 65045 LICENSING/REGULATORY SUPPLIES PEO NAME TAGSCMO/FINANCE ADMINAMAZON.COM WWW.AMAZON.25.89$ 12/06/2017 65095 OFFICE SUPPLIES RETIREMENT OF RICKEY VOSSCMO/FINANCE COMM ENGAMAZON.COM WWW.AMAZON.270.52$ 12/06/2017 64004 PEG FEE DISTRIBUTION EMERGENCY AUDIO EQUIPMENT REPLACEMENT-CHANNELS 6 & 19FIRE/ADMINANSTONAMAZON MKTPLACE PMTS119.70$ 12/05/2017 65075 MEDICAL & LAB SUPPLIES SPO2 SENSORSFIRE/ADMINANSTONAMAZON.COM AMZN.COM/BI59.99$ 12/21/2017 65075 MEDICAL & LAB SUPPLIES EMS SUPPLIESPOLICE DEPT/ADMINAMAZON MKTPLACE PMTS43.50$ 12/01/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINAMAZON MKTPLACE PMTS32.99$ 12/05/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINAMAZON.COM36.95$ 12/06/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINAMAZON MKTPLACE PMTS23.94$ 12/22/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPOLICE DEPT/ADMINAMAZONPRIME MEMBERSHIP99.00$ 12/26/2017 62295 TRAINING & TRAVEL TRAINING AND TRAVELPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS12.42$ 12/01/2017 65110 REC PROGRAM SUPPLIES BOOK TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS4.99$ 12/01/2017 65110 REC PROGRAM SUPPLIES BOOK TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS10.47$ 12/01/2017 65110 REC PROGRAM SUPPLIES PRESCHOOL PROGRAM SUPPLIESPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS140.00$ 12/01/2017 65110 REC PROGRAM SUPPLIES PUPPET STAGE BAG TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS11.26$ 12/04/2017 65110 REC PROGRAM SUPPLIES BOOKS TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON.COM AMZN.COM/BI40.78$ 12/04/2017 65110 REC PROGRAM SUPPLIES PUPPET STAGE TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS57.51$ 12/06/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS53.87$ 12/06/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS24.31$ 12/08/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS39.99$ 12/08/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS127.46$ 12/08/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS17.32$ 12/08/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAFebruary 12, 2018Page 1 of 273 of 549 Bank of America Credit Card Statement for the Period Ending December 31, 2017REPORTS TO INTERMEDIATEMERCHANT NAME TRANSACTION AMOUNT POSTING DATECOST ALLOCATION - EXPENSE OBJECT EXPENSE DESCRIPTIONPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS115.50$ 12/08/2017 65110 REC PROGRAM SUPPLIES PUPPET STAGE SUPPLIES TO BE REIMBURSED BY EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS6.83$ 12/11/2017 65110 REC PROGRAM SUPPLIES BIRTHDAY PARTY PROGRAMS TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS7.99$ 12/11/2017 65110 REC PROGRAM SUPPLIES CLASSROOM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS52.93$ 12/11/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON MKTPLACE PMTS68.97$ 12/11/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/ECOLOGY CTNRAMAZON.COM WWW.AMAZON.118.51$ 12/15/2017 65110 REC PROGRAM SUPPLIES PROGRAM AND CLASSROOM SUPPLIES TO REIMBURSED BY EEAPRCS/ECOLOGY CTNRAMAZON.COM WWW.AMAZON.164.09$ 12/26/2017 65110 REC PROGRAM SUPPLIES PROGRAM SUPPLIES TO BE REIMBURSED BY THE EEAPRCS/FLEETWOOD JOUR CNTR AMAZON MKTPLACE PMTS207.92$ 12/07/2017 65110 REC PROGRAM SUPPLIES PLAYSTATION CONTROLLERS AND DOCKINGPRCS/FLEETWOOD JOUR CNTR AMAZON.COM WWW.AMAZON.118.46$ 12/07/2017 65110 REC PROGRAM SUPPLIES HEADPHONES FOR COMPUTER LAB, CONTROLLERS FOR PLAYSTATIONPRCS/FLEETWOOD JOUR CNTR AMAZON.COM WWW.AMAZON.109.90$ 12/07/2017 65110 REC PROGRAM SUPPLIES STAFF ITEMS FOR HOLIDAY DRIVEPRCS/FLEETWOOD JOUR CNTR AMAZON MKTPLACE PMTS W89.99$ 12/15/2017 65110 REC PROGRAM SUPPLIES HOLIDAY ITEMSPRCS/NOYES CNTRAMAZON.COM AMZN.COM/BI76.26$ 12/04/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP SUPPLIESPRCS/NOYES CNTRAMAZON MKTPLACE PMTS12.26$ 12/07/2017 65110 REC PROGRAM SUPPLIES SUPPLIES FOR WINTER BREAK CAMPPRCS/NOYES CNTRAMAZON MKTPLACE PMTS W92.36$ 12/18/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP ART SUPPLIESPRCS/NOYES CNTRAMAZON MKTPLACE PMTS26.35$ 12/21/2017 65110 REC PROGRAM SUPPLIES WINTER BREAK CAMP SUPPLIESPRCS/RECREATION ADMINAMAZON.COM AMZN.COM/BI25.04$ 12/11/2017 65110 REC PROGRAM SUPPLIES ROBERTS RULES OF ORDER BOOKS FOR NOYES TENANT ASSOCPUBLIC WORKS/ENG INFAMAZON MKTPLACE PMTS W28.27$ 12/26/2017 65090 SAFETY EQUIPMENT COMPUTER MOUSE FOR A. ALONZOPUBLIC WORKS/ENVIR SVCSAMAZON MKTPLACE PMTS265.90$ 12/05/2017 65060 MATERIALS TO MAINTAIN AUTOS BACKUP CAMERAS (FLEET)PUBLIC WORKS/ENVIR SVCSAMAZON MKTPLACE PMTS W27.48$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL SHOP TOWELSPUBLIC WORKS/ENVIR SVCSAMAZON MKTPLACE PMTS49.87$ 12/27/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PARTS TRAYSPUBLIC WORKS/ENVIR SVCSAMAZON MKTPLACE PMTS W65.54$ 12/27/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL DRILL BITS, NITRILE GLOVES, LABELSPUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS37.76$ 12/01/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL GEL CELL BATTERIES.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS48.99$ 12/04/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL LENS CLEANER TOWELS.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI13.09$ 12/04/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL STAINLESS COTTER PINS.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI7.97$ 12/04/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL TOOL WAX.PUBLIC WORKS/WATER PRODAMAZON.COM WWW.AMAZON.24.99$ 12/04/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL CELL PHONE CASE.PUBLIC WORKS/WATER PRODAMAZON.COM WWW.AMAZON.143.34$ 12/04/2017 65085 MINOR EQUIP & TOOLS WIRE WHEEL BRUSHES.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI27.56$ 12/05/2017 65040 JANITORIAL SUPPLIES HAND PAPER TOWELS.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS22.90$ 12/07/2017 65085 MINOR EQUIP & TOOLS DRILL BIT SET.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI24.00$ 12/07/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL PLASTIC FOLDING CHAIR.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS4.86$ 12/12/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL BUTTON BATTERIES.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS158.27$ 12/12/2017 65085 MINOR EQUIP & TOOLS HAZARD LIGHTS, SAFETY TRIANGLE AND BATTERY TENDERS.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS10.99$ 12/15/2017 65085 MINOR EQUIP & TOOLS GEL CELL BATTERY CHARGER.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI175.48$ 12/15/2017 65085 MINOR EQUIP & TOOLS CORDED POWER WINCH.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS36.98$ 12/20/2017 65085 MINOR EQUIP & TOOLS DUCT TAPE (2-PK).PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS99.00$ 12/22/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL FRAUDULENT CHARGE.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS128.30$ 12/22/2017 65035 PETROLEUM PRODUCTS THREAD CUTTING OIL.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS W133.53$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WATER ABSORBENT PIG MATS.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI336.11$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL FRAUDULENT CHARGE.PUBLIC WORKS/WATER PRODAMAZON.COM AMZN.COM/BI98.00$ 12/26/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WATER ABSORBENT PIG MATS.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS114.97$ 12/27/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL FURNACE IGNITOR.PUBLIC WORKS/WATER PRODAMAZON MKTPLACE PMTS W35.99$ 12/28/2017 65070 OFFICE/OTHER EQ TO MAINTN MATERIAL WIRELESS MOUSE.DECEMBER AMAZON TOTAL10,571.30$ February 12, 2018Page 2 of 274 of 549 For City Council meeting of February 12, 2018 Item A3.1 Business of the City by Motion: 2018 Fuel Purchases For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Erika Storlie, Director of Administrative Services Sean Ciolek, Manager Fleet and Facilities Subject: Fuel Purchases for January 1, 2018 through July 5, 2018 Date: January 17, 2018 Recommended Action: Staff recommends City Council approval of fuel purchases for the first six (6) months of Fiscal Year 2018 in the amount of $450,000.00 from Gas Depot Oil Company (8930 N. Waukegan Road, Suite 230, Morton Grove, IL 60053). The Gas Depot Oil Company is the current Northwest Municipal Conference Bid winner through July 5, 2018 for all grades and types of fuels that are utilized by city vehicles. Funding Source: Funding for this purchase will be from the Major Maintenance, Materials to Maintain Autos Fund (Account 600.19.7710.65035). Present fuel prices are $2.11/gallon for 87 octane gasoline and $2.40/gallon for bio-diesel. FY2018 Budget: $1,100,000.00 FY2018 (January 1 – July 5, 2018) $450,000.00 Livability Benefit: Innovation & Process: Support local government best practices and processes. Summary: The Fleet Services Division of the Administrative Services Department has been purchasing fuels through the Northwest Municipal Conference Bid System for many years and has found the pricing structure to be very advantageous and in the best interest of the City of Evanston. There are no Evanston-based businesses that can provide these types of bulk deliveries of various types of fuel. Therefore, staff recommends and requests City Council approval for Fleet Services to continue to purchase bulk fuel deliveries through this conference bid award for the next six (6) months. Attachment: Joint Purchases Award Letter 5/23/17 Memorandum 75 of 549 76 of 549 77 of 549 For City Council Meeting of February 12, 2018 Item A3.2 Business of the City by Motion: FY 2018 New Tire Purchases For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Kimberly Richardson, Interim Director of Administrative Services Sean Ciolek, Division Manager of Facilities and Fleet Dave Waite, Fleet Supervisor Lisa Gray, Fleet Operations Coordinator Subject: 2018 New Tire Purchases from Wentworth Tire Service Date: January 19, 2018 Recommended Action: Staff recommends City Council approval of tire purchases for the twelve (12) months in Fiscal Year 2018 in the amount of $75,000.00 from Wentworth Tire Service (300 North York Road, Bensenville, IL). Wentworth Tire Service is an authorized distributor of tires within the Illinois State Contract # 7129. Funding Source: Funding is provided from Fleet Services/Tires and Tubes (Account 600.26.7710.65065), with a FY18 budget of $100,000. However, staff is only requesting approval for $75,000.00 for the purchasing of new tires as the remaining $25,000.00 of the tire budget is for tire repair services (tire mounting, tire dis-mounting, road repairs, and service calls for the same time period) as a separate contract. Livability Benefit: Innovation & Process: Support local government best practices and processes. Summary: The Fleet Services Division of the Administrative Services Department has been purchasing tires under State Bid Pricing for many years and has found the pricing structure to be very advantageous. From time to time staff conducts a comparative analysis of other known tire manufacturer’s online websites to verify established pricing to municipalities to ensure we are getting a cost-competitive price from the State Bid pricing (see attachment). The State Bid Pricing saves the City of Evanston on average 50% or more, per tire purchased, based on this Illinois State Contract #4017722. Memorandum 78 of 549 There are no Evanston-based businesses that can provide the various types and sizes of tires at this pricing structure for all city vehicles and equipment. Therefore, staff recommends and requests City Council approval for Fleet Services to continue to purchase tires through this State Bid Award throughout Fiscal year 2018. Attachments State Price List 2018 Illinois State Contract #4017722 79 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES 000177 Pursuit Tire Firestone FIREHAWK GT Z PURSUIT 245/55R18 $301.19 NET $0.00 $130.84 000252 Pursuit Tire Firestone FIREHAWK PVS 245/55R18 $352.49 NET $0.00 $146.07 003874 Pursuit Tire Firestone FIREHAWK GT Z PURSUIT P235/55R17 $243.49 NET $0.00 $111.70 003875 Pursuit Tire Firestone FIREHAWK GT Z PURSUIT P225/60R18 $278.55 NET $0.00 $117.94 023189 Pursuit Tire Firestone FIREHAWK GT V PURSUIT P265/60R17 $284.80 NET $0.00 $124.40 023308 Pursuit Tire Firestone FIREHAWK GT Z PURSUIT P235/50R18 $315.90 NET $0.00 $139.98 023325 Pursuit Tire Firestone FIREHAWK PVS P235/50R18 $369.71 NET $0.00 $153.20 067911 Pursuit Tire Firestone FIREHAWK PV41 P225/60R16 $159.31 NET $0.00 $97.85 077325 Pursuit Tire Firestone FIREHAWK GT Z PURSUIT P235/55R17 $243.49 NET $0.00 $111.70 077359 Pursuit Tire Firestone FIREHAWK PVS P235/55R17 $267.84 NET $0.00 $117.95 077376 Pursuit Tire Firestone FIREHAWK PVS P225/60R18 $314.59 NET $0.00 $129.10 098388 Pursuit Tire Firestone FIREHAWK PVS P225/60R16 $175.27 NET $0.00 $100.33 149558 Pursuit Tire Firestone FIREHAWK PVS P265/60R17 $274.76 NET $0.00 $121.79 150770 Light Truck Bridgestone BLIZZAK W965 LT215/85R16 E $241.60 20% $0.00 $193.28 150789 Light Truck Bridgestone BLIZZAK W965 LT235/85R16 E $261.29 20% $0.00 $209.04 150797 Light Truck Bridgestone BLIZZAK W965 LT225/75R16 E $241.70 20% $0.00 $193.36 150800 Light Truck Bridgestone BLIZZAK W965 LT245/75R16 E $261.29 20% $0.00 $209.04 156477 Light Truck Bridgestone BLIZZAK W965 LT265/75R16 E $268.32 20% $0.00 $214.66 200479 Light Truck Bridgestone BLIZZAK W965 LT245/70R17 E $284.52 20% $0.00 $227.62 207585 Light Truck Bridgestone BLIZZAK W965 LT265/70R17 E $301.84 20% $0.00 $241.48 214963 Light Truck Bridgestone BLIZZAK W965 LT235/80R17 E $304.25 20% $0.00 $243.40 062824 Light Truck Firestone CV3000 225/70R15C D $164.60 20% $0.00 $131.69 070185 Light Truck Firestone CV3000 195/70R15C D $145.63 20% $0.00 $116.51 000255 Light Truck Firestone DESTINATION A/T 31X10.50R15LT C $211.00 NET $0.00 $132.08 003472 Light Truck Firestone DESTINATION A/T P265/75R16 $212.80 NET $0.00 $127.72 Discontinued w 003474 Light Truck Firestone DESTINATION A/T P265/70R16 $221.22 NET $0.00 $129.26 Discontinued w 003476 Light Truck Firestone DESTINATION A/T P235/70R16 $188.18 NET $0.00 $114.75 Discontinued w 003478 Light Truck Firestone DESTINATION A/T P285/70R17 $255.50 NET $0.00 $131.22 Discontinued w 003479 Light Truck Firestone DESTINATION A/T P245/75R16 $196.83 NET $0.00 $137.76 Discontinued w 003481 Light Truck Firestone DESTINATION A/T P245/70R17 $220.25 NET $0.00 $118.28 Discontinued w 003635 Light Truck Firestone DESTINATION A/T P275/60R20 $297.11 NET $0.00 $143.54 Discontinued w 184278 Light Truck Firestone DESTINATION A/T LT235/75R15 C $193.50 NET $0.00 $111.92 184380 Light Truck Firestone DESTINATION A/T 30X9.50R15LT C $190.69 NET $0.00 $106.30 184414 Light Truck Firestone DESTINATION A/T 33X12.50R15LT C $253.42 NET $0.00 $155.85 184431 Light Truck Firestone DESTINATION A/T LT305/70R16 E $310.03 NET $0.19 $165.85 192302 Light Truck Firestone DESTINATION A/T LT275/70R17 C $302.80 NET $0.00 $140.84 192353 Light Truck Firestone DESTINATION A/T LT325/65R18 E $472.41 NET $3.40 $205.14 223640 Light Truck Firestone DESTINATION A/T LT285/75R16 E $295.07 NET $2.36 $157.22 223895 Light Truck Firestone DESTINATION A/T LT275/65R20 E $390.06 NET $2.36 $177.18 223912 Light Truck Firestone DESTINATION A/T LT255/75R17 C $264.27 NET $0.00 $130.16 232786 Light Truck Firestone DESTINATION A/T LT315/75R16 E $331.92 NET $3.40 $185.54 232803 Light Truck Firestone DESTINATION A/T LT285/70R17 E $341.81 NET $0.00 $156.91 232820 Light Truck Firestone DESTINATION A/T LT315/70R17 E $362.33 NET $0.00 $178.91 246998 Light Truck Firestone DESTINATION A/T LT245/75R16 E $246.14 NET $0.00 $122.70 247015 Light Truck Firestone DESTINATION A/T LT265/70R17 E $313.42 NET $0.00 $142.38 247032 Light Truck Firestone DESTINATION A/T LT265/75R16 E $271.60 NET $0.00 $131.83 247066 Light Truck Firestone DESTINATION A/T LT275/65R18 E $357.22 NET $0.00 $162.27 000172 Light Truck Firestone DESTINATION M/T 35X12.50R20LT E $351.01 NET $0.00 $260.72 Discontinued w 000173 Light Truck Firestone DESTINATION M/T LT305/55R20 E $388.88 NET $0.00 $257.37 Discontinued w 000174 Light Truck Firestone DESTINATION M/T LT245/70R17 E $231.07 NET $0.00 $155.02 Discontinued w 000175 Light Truck Firestone DESTINATION M/T LT285/70R17 E $279.17 NET $0.00 $196.53 Discontinued w 000176 Light Truck Firestone DESTINATION M/T LT315/70R17 E $326.17 NET $0.00 $200.15 Discontinued w 155543 Light Truck Firestone DESTINATION M/T LT245/75R16 E $237.35 NET $0.00 $146.34 Discontinued w 155594 Light Truck Firestone DESTINATION M/T 30X9.50R15LT C $188.32 NET $0.00 $132.39 Discontinued w 155608 Light Truck Firestone DESTINATION M/T 31X10.50R15LT C $208.74 NET $0.00 $149.58 Discontinued w 155616 Light Truck Firestone DESTINATION M/T 33X12.50R15LT C $253.03 NET $0.00 $182.70 Discontinued w 190262 Light Truck Firestone DESTINATION M/T LT305/70R16 E $276.71 NET $0.19 $189.15 Discontinued w 190296 Light Truck Firestone DESTINATION M/T LT265/70R17 E $261.53 NET $0.00 $162.52 Discontinued w 223572 Light Truck Firestone DESTINATION M/T LT285/75R16 E $266.67 NET $2.36 $184.01 Discontinued w 223589 Light Truck Firestone DESTINATION M/T LT265/75R16 E $249.46 NET $0.00 $162.12 Discontinued w 223606 Light Truck Firestone DESTINATION M/T LT215/85R16 E $204.05 NET $0.00 $121.22 223623 Light Truck Firestone DESTINATION M/T LT225/75R16 E $207.49 NET $0.00 $143.71 Discontinued w 224167 Light Truck Firestone DESTINATION M/T LT255/75R17 C $247.15 NET $0.00 $155.61 Discontinued w 232735 Light Truck Firestone DESTINATION M/T LT315/75R16 E $295.95 NET $3.40 $216.02 Discontinued w 250296 Light Truck Firestone DESTINATION M/T LT275/70R18 E $284.59 NET $1.32 $197.24 Discontinued w 250313 Light Truck Firestone DESTINATION M/T LT285/65R18 E $363.90 NET $1.32 $188.68 Discontinued w 250347 Light Truck Firestone DESTINATION M/T LT275/65R20 E $346.83 NET $2.36 $207.53 Discontinued w 003456 Light Truck Firestone DESTINATION M/T2 LT295/70R18 E $310.14 20% $5.48 $248.12 003457 Light Truck Firestone DESTINATION M/T2 LT275/65R18 E $294.84 20% $0.00 $235.88 003459 Light Truck Firestone DESTINATION M/T2 LT245/75R17 E $224.98 20% $0.00 $179.99 003461 Light Truck Firestone DESTINATION M/T2 LT315/75R16 E $281.14 NET $3.40 $216.02 003462 Light Truck Firestone DESTINATION M/T2 LT235/85R16 E $208.50 20% $0.00 $166.80 003463 Light Truck Firestone DESTINATION M/T2 32X11.50R15LT C $196.23 20% $0.00 $156.99 003493 Light Truck Firestone DESTINATION M/T2 LT235/75R15 C $183.93 20% $0.00 $147.15 003803 Light Truck Firestone DESTINATION M/T2 37X12.50R17LT D $317.61 20% $0.19 $254.09 003805 Light Truck Firestone DESTINATION M/T2 37X13.50R20LT E $404.81 20% $3.40 $323.86 003806 Light Truck Firestone DESTINATION M/T2 37X13.50R22LT E $457.05 20% $0.00 $365.65 003808 Light Truck Firestone DESTINATION M/T2 LT295/70R17 E $258.45 20% $0.00 $206.76 003810 Light Truck Firestone DESTINATION M/T2 35X12.50R17LT E $342.21 20% $0.00 $273.77 003811 Light Truck Firestone DESTINATION M/T2 35X12.50R18LT E $318.50 20% $0.00 $254.81 003812 Light Truck Firestone DESTINATION M/T2 35X12.50R20LT E $290.25 NET $0.00 $232.20 003813 Light Truck Firestone DESTINATION M/T2 33X12.50R20LT E $314.70 20% $0.00 $251.77 003814 Light Truck Firestone DESTINATION M/T2 35X12.50R22LT E $360.16 20% $0.00 $288.14 003815 Light Truck Firestone DESTINATION M/T2 33X12.50R17LT E $237.20 20% $0.00 $189.76 245502 Light Truck Firestone DESTINATION M/T2 31X10.50R15LT C $198.31 NET $0.00 $149.58 245519 Light Truck Firestone DESTINATION M/T2 33X12.50R15LT C $227.75 NET $0.00 $182.20 245587 Light Truck Firestone DESTINATION M/T2 LT245/75R16 E $225.48 20% $0.00 $180.39 245604 Light Truck Firestone DESTINATION M/T2 LT265/75R16 E $236.99 NET $0.00 $162.12 245621 Light Truck Firestone DESTINATION M/T2 LT285/75R16 E $239.99 NET $2.36 $184.01 245655 Light Truck Firestone DESTINATION M/T2 LT255/75R17 C $234.79 20% $0.00 $187.83 245723 Light Truck Firestone DESTINATION M/T2 LT265/70R17 E $248.46 NET $0.00 $162.52 245740 Light Truck Firestone DESTINATION M/T2 LT285/70R17 E $237.30 NET $0.00 $189.84 245757 Light Truck Firestone DESTINATION M/T2 LT315/70R17 E $262.31 NET $0.00 $200.15 245825 Light Truck Firestone DESTINATION M/T2 LT275/70R18 E $257.68 NET $1.32 $197.24 245859 Light Truck Firestone DESTINATION M/T2 LT285/65R18 E $292.49 NET $1.32 $188.68 245927 Light Truck Firestone DESTINATION M/T2 LT275/65R20 E $278.83 NET $2.36 $207.53 206480 Light Truck Bridgestone DUELER A/T REVO 2 LT285/75R16 E $316.72 NET $2.36 $162.21 206514 Light Truck Bridgestone DUELER A/T REVO 2 LT285/65R18 E $402.46 NET $1.32 $180.22 206531 Light Truck Bridgestone DUELER A/T REVO 2 LT265/70R17 E $304.36 NET $0.00 $158.39 206548 Light Truck Bridgestone DUELER A/T REVO 2 LT265/75R16 E $298.32 NET $0.00 $184.06 212056 Light Truck Bridgestone DUELER A/T REVO 2 LT275/65R18 E $398.93 NET $0.00 $168.02 212107 Light Truck Bridgestone DUELER A/T REVO 2 LT245/75R16 E $266.70 NET $0.00 $156.96 212124 Light Truck Bridgestone DUELER A/T REVO 2 LT235/85R16 E $269.63 NET $0.00 $128.83 Non-Contract State Price List Page 1 of 5680 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 212141 Light Truck Bridgestone DUELER A/T REVO 2 31X10.50R15LT C $246.34 NET $0.00 $128.71 212158 Light Truck Bridgestone DUELER A/T REVO 2 LT285/70R17 E $329.21 NET $0.00 $163.82 212175 Light Truck Bridgestone DUELER A/T REVO 2 LT245/70R17 E $286.58 NET $0.00 $133.46 212192 Light Truck Bridgestone DUELER A/T REVO 2 LT245/75R17 E $297.16 NET $0.00 $137.04 214623 Light Truck Bridgestone DUELER A/T REVO 2 LT275/65R20 E $422.00 NET $2.36 $177.77 223861 Light Truck Bridgestone DUELER A/T REVO 2 LT255/75R17 C $299.75 NET $0.00 $137.19 232497 Light Truck Bridgestone DUELER A/T REVO 2 LT315/70R17 E $361.68 NET $0.00 $181.52 245451 Light Truck Bridgestone DUELER A/T REVO 2 LT275/70R18 E $378.98 NET $0.00 $158.93 246505 Light Truck Bridgestone DUELER A/T RH-S LT265/70R17 C $275.25 20% $0.00 $220.21 006783 Light Truck Bridgestone DUELER H/P SPORT 215/65R16 $173.64 20% $0.00 $138.92 006786 Light Truck Bridgestone DUELER H/P SPORT 225/55R18 $208.98 20% $0.00 $167.18 001333 Light Truck Bridgestone DUELER H/T 685 LT215/85R16 E $180.38 20% $0.00 $144.30 001334 Light Truck Bridgestone DUELER H/T 685 LT235/85R16 E $196.67 20% $0.00 $157.33 001335 Light Truck Bridgestone DUELER H/T 685 LT225/75R16 E $185.67 20% $0.00 $148.54 001336 Light Truck Bridgestone DUELER H/T 685 LT245/75R16 E $194.62 20% $0.00 $155.70 001337 Light Truck Bridgestone DUELER H/T 685 LT265/75R16 E $206.15 20% $0.00 $164.92 001338 Light Truck Bridgestone DUELER H/T 685 LT285/75R16 E $222.97 20% $0.00 $178.38 001339 Light Truck Bridgestone DUELER H/T 685 LT235/80R17 E $214.11 20% $0.00 $171.29 001341 Light Truck Bridgestone DUELER H/T 685 LT245/75R17 E $230.26 20% $0.00 $184.21 001342 Light Truck Bridgestone DUELER H/T 685 LT245/70R17 E $208.95 20% $0.00 $167.16 001343 Light Truck Bridgestone DUELER H/T 685 LT265/70R17 E $230.53 20% $0.00 $184.42 001345 Light Truck Bridgestone DUELER H/T 685 LT285/70R17 E $239.75 20% $0.00 $191.80 001346 Light Truck Bridgestone DUELER H/T 685 LT265/70R18 E $232.74 20% $0.00 $186.19 001347 Light Truck Bridgestone DUELER H/T 685 LT275/70R18 E $261.42 20% $0.00 $209.14 001348 Light Truck Bridgestone DUELER H/T 685 LT275/65R18 E $274.49 20% $0.00 $219.59 001349 Light Truck Bridgestone DUELER H/T 685 LT275/65R20 E $280.21 20% $0.00 $224.16 001350 Light Truck Bridgestone DUELER H/T 685 LT265/60R20 E $282.90 20% $0.00 $226.32 006004 Light Truck Bridgestone DUELER H/T 685 LT285/60R20 E $305.99 20% $1.32 $244.79 190840 Light Truck Bridgestone DURAVIS M700 LT265/70R17 E $275.95 NET $0.00 $156.12 206242 Light Truck Bridgestone DURAVIS M700 HD LT235/80R17 E $254.46 NET $0.00 $165.34 206276 Light Truck Bridgestone DURAVIS M700 HD LT265/70R17 E $275.95 NET $0.00 $178.68 206293 Light Truck Bridgestone DURAVIS M700 HD LT265/75R16 E $242.11 NET $0.00 $158.62 206310 Light Truck Bridgestone DURAVIS M700 HD LT245/75R16 E $228.15 NET $0.00 $149.20 213518 Light Truck Bridgestone DURAVIS M700 HD LT225/75R16 E $208.18 NET $0.00 $136.84 214589 Light Truck Bridgestone DURAVIS M700 HD LT235/85R16 E $226.26 NET $0.00 $148.26 214606 Light Truck Bridgestone DURAVIS M700 HD LT215/85R16 E $208.18 NET $0.00 $136.81 208231 Light Truck Bridgestone DURAVIS M773 II LT245/75R16 E $229.67 NET $0.00 $132.97 002036 Light Truck Bridgestone DURAVIS R238 LT245/75R16 E $270.07 20% $0.00 $216.06 002038 Light Truck Bridgestone DURAVIS R238 LT225/75R16 E $252.42 20% $0.00 $201.93 002039 Light Truck Bridgestone DURAVIS R238 LT245/75R17 E $292.35 20% $0.00 $233.88 002043 Light Truck Bridgestone DURAVIS R238 LT215/85R16 E $252.42 20% $0.00 $201.93 002044 Light Truck Bridgestone DURAVIS R238 LT235/85R16 E $273.04 20% $0.00 $218.43 206327 Light Truck Bridgestone DURAVIS R250 LT215/85R16 E $252.42 NET $0.00 $189.45 Discontinued w 206361 Light Truck Bridgestone DURAVIS R250 LT225/75R16 E $252.42 NET $0.00 $194.34 Discontinued w 206378 Light Truck Bridgestone DURAVIS R250 LT235/85R16 E $273.04 NET $0.00 $200.64 Discontinued w 210815 Light Truck Bridgestone DURAVIS R250 LT245/75R16 E $270.07 NET $0.00 $199.78 Discontinued w 223555 Light Truck Bridgestone DURAVIS R250 LT225/75R17 E $270.90 NET $0.00 $189.38 Discontinued w 191826 Light Truck Bridgestone DURAVIS R500 HD LT215/85R16 E $196.65 NET $0.00 $128.98 191843 Light Truck Bridgestone DURAVIS R500 HD LT235/85R16 E $214.40 NET $0.00 $140.62 191860 Light Truck Bridgestone DURAVIS R500 HD LT245/75R16 E $212.16 NET $0.00 $139.04 191877 Light Truck Bridgestone DURAVIS R500 HD LT265/75R16 E $224.73 NET $0.00 $152.59 191894 Light Truck Bridgestone DURAVIS R500 HD LT245/70R17 E $227.78 NET $0.00 $147.99 191911 Light Truck Bridgestone DURAVIS R500 HD LT265/70R17 E $241.65 NET $0.00 $157.26 191928 Light Truck Bridgestone DURAVIS R500 HD LT235/80R17 E $233.40 NET $0.00 $151.47 192659 Light Truck Bridgestone DURAVIS R500 HD LT225/75R16 E $202.41 NET $0.00 $132.49 003770 Light Truck Bridgestone DURAVIS R630 195/75R16C D $199.81 20% $0.00 $159.85 225340 Light Truck Bridgestone DURAVIS R630 225/70R15C D $201.90 20% $0.00 $161.52 225357 Light Truck Bridgestone DURAVIS R630 195/70R15C D $199.31 20% $0.00 $159.45 267775 Light Truck Bridgestone R187 METRO RADIAL 8R19.5 12 $285.05 20% $0.19 $228.04 003488 Light Truck Firestone TRANSFORCE AT LT265/70R17 E $206.12 20% $0.00 $164.90 189582 Light Truck Firestone TRANSFORCE AT LT245/75R16 E $177.76 NET $0.00 $120.58 Discontinued w 189633 Light Truck Firestone TRANSFORCE AT LT235/85R16 E $188.96 NET $0.00 $124.75 Discontinued w 189667 Light Truck Firestone TRANSFORCE AT LT225/75R16 E $175.47 NET $0.00 $118.89 Discontinued w 191265 Light Truck Firestone TRANSFORCE AT LT235/80R17 E $196.29 NET $0.00 $128.27 Discontinued w 192234 Light Truck Firestone TRANSFORCE AT LT245/70R17 C $193.57 NET $0.00 $117.32 196858 Light Truck Firestone TRANSFORCE AT LT265/75R16 E $196.20 NET $0.00 $137.41 Discontinued w 200173 Light Truck Firestone TRANSFORCE AT LT245/70R17 E $201.40 NET $0.00 $125.97 Discontinued w 200190 Light Truck Firestone TRANSFORCE AT LT265/70R17 E $216.98 NET $0.00 $142.88 Discontinued w 200207 Light Truck Firestone TRANSFORCE AT LT275/65R18 E $257.22 NET $0.00 $155.70 Discontinued w 205205 Light Truck Firestone TRANSFORCE AT LT275/70R18 E $242.55 NET $1.32 $156.35 Discontinued w 205222 Light Truck Firestone TRANSFORCE AT LT245/75R17 E $213.95 NET $0.00 $129.64 Discontinued w 224150 Light Truck Firestone TRANSFORCE AT LT225/75R17 E $190.88 NET $0.00 $115.80 Discontinued w 250126 Light Truck Firestone TRANSFORCE AT LT285/60R20 E $343.21 NET $0.00 $149.96 250381 Light Truck Firestone TRANSFORCE AT LT275/70R18 E $242.55 NET $1.32 $144.08 000178 Light Truck Firestone TRANSFORCE AT2 LT215/85R16 E $166.29 NET $0.00 $108.32 000179 Light Truck Firestone TRANSFORCE AT2 LT235/85R16 E $181.93 NET $0.00 $124.75 000180 Light Truck Firestone TRANSFORCE AT2 LT225/75R16 E $168.95 NET $0.00 $118.89 000181 Light Truck Firestone TRANSFORCE AT2 LT245/75R16 E $171.14 NET $0.00 $120.58 000182 Light Truck Firestone TRANSFORCE AT2 LT265/75R16 E $179.82 NET $0.00 $134.39 000183 Light Truck Firestone TRANSFORCE AT2 LT225/75R17 E $183.77 NET $0.00 $115.80 000184 Light Truck Firestone TRANSFORCE AT2 LT245/75R17 E $205.98 NET $0.00 $129.64 000185 Light Truck Firestone TRANSFORCE AT2 LT235/80R17 E $188.98 NET $0.00 $128.27 000186 Light Truck Firestone TRANSFORCE AT2 LT245/70R17 E $193.90 NET $0.00 $125.97 000187 Light Truck Firestone TRANSFORCE AT2 LT265/70R17 E $208.90 NET $0.00 $142.88 000188 Light Truck Firestone TRANSFORCE AT2 LT265/70R18 E $241.21 20% $0.00 $192.96 000189 Light Truck Firestone TRANSFORCE AT2 LT275/70R18 E $233.52 NET $0.00 $156.35 000190 Light Truck Firestone TRANSFORCE AT2 LT275/65R18 E $247.63 NET $0.00 $155.70 000191 Light Truck Firestone TRANSFORCE AT2 LT275/65R20 E $293.76 20% $0.00 $235.00 000192 Light Truck Firestone TRANSFORCE AT2 LT265/60R20 E $327.67 20% $0.00 $262.12 000780 Light Truck Firestone TRANSFORCE AT2 LT285/70R17 E $225.95 20% $0.00 $180.75 000011 Light Truck Firestone TRANSFORCE HT LT265/70R18 E $205.54 NET $0.00 $141.48 002028 Light Truck Firestone TRANSFORCE HT 205/65R15C C $131.50 20% $0.00 $105.20 003490 Light Truck Firestone TRANSFORCE HT LT245/75R17 E $192.30 20% $0.00 $153.84 003560 Light Truck Firestone TRANSFORCE HT 195/75R16C D $124.41 20% $0.00 $99.53 003561 Light Truck Firestone TRANSFORCE HT 235/65R16C E $161.52 20% $0.00 $129.22 189701 Light Truck Firestone TRANSFORCE HT LT215/85R16 E $157.46 NET $0.00 $107.67 189718 Light Truck Firestone TRANSFORCE HT LT235/85R16 E $164.85 NET $0.00 $119.39 189752 Light Truck Firestone TRANSFORCE HT LT225/75R16 E $165.10 NET $0.00 $116.00 189769 Light Truck Firestone TRANSFORCE HT LT245/75R16 E $167.49 NET $0.00 $114.50 189786 Light Truck Firestone TRANSFORCE HT LT265/75R16 E $176.43 NET $0.00 $131.29 189803 Light Truck Firestone TRANSFORCE HT 8.75R16.5LT E $165.10 NET $0.00 $106.03 189820 Light Truck Firestone TRANSFORCE HT 9.50R16.5LT E $182.89 NET $0.00 $120.65 189837 Light Truck Firestone TRANSFORCE HT LT235/75R15 C $143.55 NET $0.00 $103.67 Page 2 of 5681 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 191282 Light Truck Firestone TRANSFORCE HT LT235/80R17 E $183.13 NET $0.00 $123.58 191316 Light Truck Firestone TRANSFORCE HT LT245/70R17 E $178.75 NET $0.00 $125.05 200156 Light Truck Firestone TRANSFORCE HT LT265/70R17 E $201.13 NET $0.00 $139.56 207483 Light Truck Firestone TRANSFORCE HT LT245/75R17 E $202.43 NET $0.00 $128.61 207500 Light Truck Firestone TRANSFORCE HT LT275/70R18 E $224.81 NET $1.32 $150.65 207602 Light Truck Firestone TRANSFORCE HT LT265/75R16 E $185.63 NET $0.00 $134.04 207619 Light Truck Firestone TRANSFORCE HT LT275/65R18 E $237.65 NET $0.00 $151.51 224133 Light Truck Firestone TRANSFORCE HT LT225/75R17 E $178.07 NET $0.00 $113.46 225425 Light Truck Firestone TRANSFORCE HT LT245/75R17 E $192.30 NET $0.00 $125.96 232990 Light Truck Firestone TRANSFORCE HT LT245/70R17 E $178.75 NET $0.00 $121.98 233007 Light Truck Firestone TRANSFORCE HT LT245/75R17 E $202.43 NET $0.00 $127.53 250109 Light Truck Firestone TRANSFORCE HT LT275/70R18 E $214.10 NET $1.32 $134.83 003489 Light Truck Bridgestone V-STEEL RIB 265 LT245/75R16 E $186.14 20% $0.00 $148.91 004650 Light Truck Bridgestone V-STEEL RIB 265 LT245/75R16 E $229.65 20% $0.00 $183.72 154075 Light Truck Bridgestone V-STEEL RIB 265 LT245/75R16 E $229.65 20% $0.00 $183.72 157791 Light Truck Bridgestone V-STEEL RIB 265 LT245/75R16 E $229.65 20% $0.00 $183.72 006005 Light Truck Firestone WINTERFORCE LT LT265/70R18 E $312.28 20% $0.00 $249.82 232871 Light Truck Firestone WINTERFORCE LT LT275/65R20 E $365.49 NET $0.00 $173.09 232973 Light Truck Firestone WINTERFORCE LT LT255/75R17 C $281.75 20% $0.00 $225.39 246250 Light Truck Firestone WINTERFORCE LT LT225/75R16 E $231.92 NET $0.00 $123.15 246267 Light Truck Firestone WINTERFORCE LT LT245/75R16 E $250.69 NET $0.00 $127.70 246284 Light Truck Firestone WINTERFORCE LT LT265/75R16 E $257.45 NET $0.00 $139.05 246318 Light Truck Firestone WINTERFORCE LT LT235/85R16 E $250.69 NET $0.00 $126.79 246335 Light Truck Firestone WINTERFORCE LT LT245/75R17 E $270.92 NET $0.00 $133.39 246369 Light Truck Firestone WINTERFORCE LT LT235/80R17 E $291.94 NET $0.00 $129.12 246386 Light Truck Firestone WINTERFORCE LT LT285/75R16 E $278.46 NET $2.36 $159.53 246403 Light Truck Firestone WINTERFORCE LT LT275/70R18 E $325.29 NET $1.32 $159.22 246420 Light Truck Firestone WINTERFORCE LT LT225/75R17 E $250.47 NET $0.00 $121.02 246437 Light Truck Firestone WINTERFORCE LT LT275/65R18 E $344.81 NET $0.00 $157.00 246454 Light Truck Firestone WINTERFORCE LT LT245/70R17 E $272.98 NET $0.00 $136.88 246471 Light Truck Firestone WINTERFORCE LT LT265/70R17 E $289.60 NET $0.00 $149.09 246488 Light Truck Firestone WINTERFORCE LT LT215/85R16 E $231.79 NET $0.00 $110.32 219696 Medium Truck Firestone FD600 315/80R22.5 18 $1,226.88 40% $45.08 $736.13 151009 Medium Truck Firestone FD663 12R22.5 16 $691.05 40% $36.76 $414.63 211206 Medium Truck Firestone FD663 11R22.5 16 $606.13 40% $29.39 $363.68 281034 Medium Truck Firestone FD663 10R22.5 12 $532.53 40% $16.07 $319.52 281042 Medium Truck Firestone FD663 11R22.5 14 $587.47 NET $25.23 $339.78 281050 Medium Truck Firestone FD663 295/75R22.5 14 $587.47 NET $25.23 $339.78 281069 Medium Truck Firestone FD663 11R24.5 14 $626.77 40% $29.39 $376.06 281077 Medium Truck Firestone FD663 285/75R24.5 14 $626.77 40% $25.23 $376.06 293733 Medium Truck Firestone FD663 11R24.5 16 $660.27 40% $34.59 $396.16 006504 Medium Truck Firestone FD690 PLUS 11R22.5 14 $573.31 40% $25.23 $343.99 006506 Medium Truck Firestone FD690 PLUS 11R24.5 14 $613.44 40% $29.39 $368.06 006510 Medium Truck Firestone FD690 PLUS 245/70R19.5 14 $429.68 40% $9.83 $257.81 006514 Medium Truck Firestone FD690 PLUS 295/75R22.5 14 $573.31 40% $25.23 $343.99 006516 Medium Truck Firestone FD690 PLUS 285/75R24.5 14 $613.44 40% $25.23 $368.06 186675 Medium Truck Firestone FD690 PLUS 225/70R19.5 12 $397.31 40% $1.32 $238.39 227074 Medium Truck Firestone FD690 PLUS 225/70R19.5 14 $408.77 40% $4.44 $245.26 241524 Medium Truck Firestone FD691 295/75R22.5 14 $604.16 40% $25.23 $362.50 241541 Medium Truck Firestone FD691 285/75R24.5 14 $650.30 40% $25.23 $390.18 241558 Medium Truck Firestone FD691 11R22.5 14 $604.16 40% $25.23 $362.50 241575 Medium Truck Firestone FD691 11R24.5 14 $650.30 40% $29.39 $390.18 208945 Medium Truck Firestone FD835 11R24.5 16 $762.62 40% $34.59 $457.57 004168 Medium Truck Firestone FS400 315/80R22.5 20 $970.61 NET $55.47 $506.73 192982 Medium Truck Firestone FS560 255/70R22.5 16 $490.57 NET $18.99 $288.56 156531 Medium Truck Firestone FS560 PLUS 11R22.5 14 $536.55 NET $25.23 $301.21 156558 Medium Truck Firestone FS560 PLUS 11R22.5 16 $552.65 NET $29.39 $313.22 156566 Medium Truck Firestone FS560 PLUS 295/75R22.5 14 $536.55 NET $25.23 $301.21 156574 Medium Truck Firestone FS560 PLUS 11R24.5 14 $555.99 40% $29.39 $333.59 156582 Medium Truck Firestone FS560 PLUS 11R24.5 16 $576.64 40% $34.59 $345.98 156590 Medium Truck Firestone FS560 PLUS 285/75R24.5 14 $555.99 40% $25.23 $333.59 248273 Medium Truck Firestone FS561 295/75R22.5 14 $583.77 NET $25.23 $319.28 248290 Medium Truck Firestone FS561 285/75R24.5 14 $623.42 40% $25.23 $374.05 248307 Medium Truck Firestone FS561 11R22.5 14 $583.77 NET $25.23 $319.28 248324 Medium Truck Firestone FS561 11R22.5 16 $598.65 NET $29.39 $332.01 248358 Medium Truck Firestone FS561 11R24.5 14 $623.42 40% $29.39 $374.05 248375 Medium Truck Firestone FS561 11R24.5 16 $657.04 40% $34.59 $394.22 248409 Medium Truck Firestone FS561 225/70R19.5 12 $403.29 40% $1.32 $241.97 248426 Medium Truck Firestone FS561 225/70R19.5 14 $414.86 40% $4.44 $248.92 248443 Medium Truck Firestone FS561 245/70R19.5 12 $423.79 40% $5.48 $254.27 248477 Medium Truck Firestone FS561 245/70R19.5 14 $435.99 40% $9.83 $261.59 248494 Medium Truck Firestone FS561 12R22.5 16 $659.81 40% $36.76 $395.89 248511 Medium Truck Firestone FS561 215/75R17.5 16 $399.99 40% $12.29 $239.99 248545 Medium Truck Firestone FS561 275/70R22.5 18 $577.64 40% $32.51 $346.58 248562 Medium Truck Firestone FS561 9R22.5 12 $479.37 40% $9.83 $287.62 248579 Medium Truck Firestone FS561 10R22.5 12 $526.04 40% $16.07 $315.62 248596 Medium Truck Firestone FS561 10R22.5 14 $539.45 40% $20.51 $323.67 233738 Medium Truck Firestone FS591 295/75R22.5 14 $626.52 40% $25.23 $375.91 233755 Medium Truck Firestone FS591 295/75R22.5 16 $644.45 40% $34.59 $386.67 238498 Medium Truck Firestone FS591 285/75R24.5 14 $658.97 40% $25.23 $395.38 238532 Medium Truck Firestone FS591 11R22.5 14 $626.52 40% $25.23 $375.91 238549 Medium Truck Firestone FS591 11R22.5 16 $644.45 40% $29.39 $386.67 238566 Medium Truck Firestone FS591 11R24.5 14 $658.97 40% $29.39 $395.38 238583 Medium Truck Firestone FS591 11R24.5 16 $692.03 40% $34.59 $415.22 241235 Medium Truck Firestone FS818 425/65R22.5 20 $940.59 NET $37.33 $598.21 247780 Medium Truck Firestone FS818 385/65R22.5 18 $828.24 NET $27.74 $526.76 247797 Medium Truck Firestone FS818 445/65R22.5 20 $1,028.91 NET $41.58 $654.39 233840 Medium Truck Firestone FS820 11R24.5 16 $638.39 40% $34.59 $383.03 233874 Medium Truck Firestone FS820 315/80R22.5 20 $802.91 40% $52.83 $481.75 241252 Medium Truck Firestone FS820 11R22.5 16 $598.39 40% $29.39 $359.03 006634 Medium Truck Firestone FT491 11R22.5 14 $533.66 40% $25.23 $320.20 006635 Medium Truck Firestone FT491 11R24.5 14 $559.23 40% $29.39 $335.54 006636 Medium Truck Firestone FT491 255/70R22.5 16 $489.02 40% $18.99 $293.41 006638 Medium Truck Firestone FT491 295/75R22.5 14 $533.66 40% $25.23 $320.20 006640 Medium Truck Firestone FT491 285/75R24.5 14 $559.23 40% $25.23 $335.54 238617 Medium Truck Firestone FT491 295/75R22.5 14 $533.66 40% $25.23 $320.20 238634 Medium Truck Firestone FT491 285/75R24.5 14 $559.23 40% $25.23 $335.54 238668 Medium Truck Firestone FT491 11R22.5 14 $533.66 40% $25.23 $320.20 238685 Medium Truck Firestone FT491 11R24.5 14 $559.23 40% $29.39 $335.54 238702 Medium Truck Firestone FT491 255/70R22.5 16 $489.02 40% $18.99 $293.41 233517 Medium Truck Bridgestone GREATEC M835 ECOPIA 445/50R22.5 20 $1,606.13 43% $31.66 $915.49 241609 Medium Truck Bridgestone GREATEC M835A ECOPIA 445/50R22.5 20 $1,606.12 43% $31.66 $915.49 241422 Medium Truck Bridgestone GREATEC M845 455/55R22.5 22 $1,771.58 43% $38.75 $1,009.80 Page 3 of 5682 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 006712 Medium Truck Bridgestone GREATEC M853 455/55R22.5 22 $1,793.83 43% $38.75 $1,022.48 250092 Medium Truck Bridgestone GREATEC R135 ECOPIA 445/50R22.5 20 $1,395.55 43% $31.66 $795.46 006713 Medium Truck Bridgestone GREATEC R197 ECOPIA 445/50R22.5 20 $1,395.55 43% $31.66 $795.46 199986 Medium Truck Bridgestone L315 445/65R22.5 20 $1,380.81 43% $41.58 $787.06 241354 Medium Truck Bridgestone L315 385/65R22.5 18 $1,182.15 43% $27.74 $673.83 241371 Medium Truck Bridgestone L315 425/65R22.5 20 $1,328.27 43% $37.33 $757.11 262986 Medium Truck Bridgestone L317 12.00R24 18 $1,140.90 43% $0.00 $650.31 186318 Medium Truck Bridgestone L320 11R22.5 16 $914.21 43% $29.39 $521.10 186335 Medium Truck Bridgestone L320 11R24.5 16 $975.28 43% $34.59 $555.91 193373 Medium Truck Bridgestone L320 12.00R24 18 $1,263.73 43% $55.47 $720.33 208350 Medium Truck Bridgestone L320 11R22.5 14 $886.78 43% $25.23 $505.46 211019 Medium Truck Bridgestone L320 12R22.5 16 $1,045.07 43% $36.76 $595.69 153001 Medium Truck Bridgestone L355EZ 12.00R24 18 $1,178.82 43% $55.47 $671.93 233313 Medium Truck Bridgestone M710 ECOPIA 285/75R24.5 14 $878.71 43% $25.23 $500.86 233330 Medium Truck Bridgestone M710 ECOPIA 11R22.5 14 $823.97 43% $25.23 $469.66 233347 Medium Truck Bridgestone M710 ECOPIA 11R24.5 14 $878.71 43% $29.39 $500.86 233466 Medium Truck Bridgestone M710 ECOPIA 295/75R22.5 14 $823.97 43% $25.23 $469.66 265225 Medium Truck Bridgestone M711 11R22.5 14 $792.19 43% $25.23 $451.55 265233 Medium Truck Bridgestone M711 11R24.5 14 $851.00 43% $29.39 $485.07 001712 Medium Truck Bridgestone M724F 245/70R19.5 16 $521.81 43% $13.61 $297.43 272876 Medium Truck Bridgestone M724F 225/70R19.5 12 $492.27 43% $1.32 $280.59 297585 Medium Truck Bridgestone M726 255/70R22.5 16 $756.27 43% $18.99 $431.07 240249 Medium Truck Bridgestone M726EL 11R22.5 14 $897.16 43% $25.23 $511.38 240504 Medium Truck Bridgestone M726EL 295/75R22.5 14 $897.16 43% $25.23 $511.38 241728 Medium Truck Bridgestone M726EL 11R22.5 14 $897.16 43% $25.23 $511.38 005311 Medium Truck Bridgestone M726ELA 295/75R22.5 14 $794.41 43% $25.23 $452.81 005312 Medium Truck Bridgestone M726ELA 285/75R24.5 14 $847.04 43% $25.23 $482.81 005313 Medium Truck Bridgestone M726ELA 11R22.5 14 $794.41 43% $25.23 $452.81 005314 Medium Truck Bridgestone M726ELA 11R24.5 14 $847.04 43% $29.39 $482.81 005315 Medium Truck Bridgestone M726ELA 11R24.5 16 $871.17 43% $34.59 $496.57 005316 Medium Truck Bridgestone M726ELA 10R22.5 14 $738.81 43% $20.51 $421.12 150266 Medium Truck Bridgestone M729 11R24.5 16 $818.19 43% $34.59 $466.37 160427 Medium Truck Bridgestone M729 215/75R17.5 12 $762.12 43% $2.36 $434.41 152498 Medium Truck Bridgestone M729F 265/70R19.5 14 $748.75 43% $18.99 $426.79 158914 Medium Truck Bridgestone M729F 285/70R19.5 16 $784.10 43% $27.31 $446.94 227023 Medium Truck Bridgestone M729F 225/70R19.5 14 $591.55 43% $4.44 $337.18 227040 Medium Truck Bridgestone M729F 245/70R19.5 16 $653.66 43% $13.61 $372.59 299839 Medium Truck Bridgestone M729F 225/70R19.5 12 $569.82 43% $1.32 $324.80 168740 Medium Truck Bridgestone M729Z 295/80R22.5 16 $934.46 43% $40.92 $532.64 224966 Medium Truck Bridgestone M749 295/60R22.5 18 $981.21 43% $36.76 $559.29 247899 Medium Truck Bridgestone M760 ECOPIA 295/75R22.5 14 $840.44 43% $25.23 $479.05 247916 Medium Truck Bridgestone M760 ECOPIA 285/75R24.5 14 $896.29 43% $25.23 $510.89 247933 Medium Truck Bridgestone M760 ECOPIA 11R22.5 14 $840.44 43% $25.23 $479.05 247950 Medium Truck Bridgestone M760 ECOPIA 11R24.5 14 $896.29 43% $29.39 $510.89 187610 Medium Truck Bridgestone M770 285/75R24.5 14 $830.90 43% $25.23 $473.61 187644 Medium Truck Bridgestone M770 11R22.5 14 $779.28 43% $25.23 $444.19 187695 Medium Truck Bridgestone M770 11R24.5 14 $830.90 43% $29.39 $473.61 211104 Medium Truck Bridgestone M770 11R22.5 16 $802.65 43% $29.39 $457.51 233364 Medium Truck Bridgestone M770 295/75R22.5 14 $779.28 43% $25.23 $444.19 157767 Medium Truck Bridgestone M775 11R24.5 16 $981.90 43% $34.59 $559.68 202604 Medium Truck Bridgestone M775 11R22.5 16 $920.40 43% $29.39 $524.63 202621 Medium Truck Bridgestone M775 12R22.5 16 $1,058.45 43% $36.76 $603.32 233585 Medium Truck Bridgestone M799 11R24.5 16 $854.57 43% $34.59 $487.10 233602 Medium Truck Bridgestone M799 12R22.5 16 $921.61 43% $36.76 $525.32 245434 Medium Truck Bridgestone M799 11R22.5 16 $801.39 43% $29.39 $456.79 005820 Medium Truck Bridgestone M840 12.00R20 18 $885.21 43% $0.00 $504.57 152994 Medium Truck Bridgestone M840 12.00R24 18 $1,094.71 43% $55.47 $623.98 202451 Medium Truck Bridgestone M840 275/70R22.5 18 $755.28 43% $32.51 $430.51 001714 Medium Truck Bridgestone M843 315/80R22.5 20 $1,265.31 43% $52.83 $721.23 287849 Medium Truck Bridgestone M843 11R22.5 14 $932.62 43% $25.23 $531.59 287857 Medium Truck Bridgestone M843 11R22.5 16 $960.59 43% $29.39 $547.54 287873 Medium Truck Bridgestone M843 11R24.5 16 $1,027.83 43% $34.59 $585.86 287881 Medium Truck Bridgestone M843 12R22.5 16 $1,104.67 43% $36.76 $629.66 287903 Medium Truck Bridgestone M843 12R24.5 16 $1,142.84 43% $40.92 $651.42 225000 Medium Truck Bridgestone M853 11R22.5 16 $854.21 43% $29.39 $486.90 225034 Medium Truck Bridgestone M853 11R24.5 16 $914.00 43% $34.59 $520.98 225051 Medium Truck Bridgestone M853 12R22.5 16 $982.33 43% $36.76 $559.93 233092 Medium Truck Bridgestone M853 11R24.5 16 $977.60 43% $34.59 $557.23 233670 Medium Truck Bridgestone M854 425/65R22.5 20 $1,328.27 43% $37.33 $757.11 241439 Medium Truck Bridgestone M854 385/65R22.5 18 $1,169.92 43% $27.74 $666.85 241456 Medium Truck Bridgestone M854 445/65R22.5 22 $1,495.08 43% $43.94 $852.20 289779 Medium Truck Bridgestone M857 11.00R24 16 $1,052.26 43% $45.08 $599.79 295876 Medium Truck Bridgestone M857 255/70R22.5 16 $650.43 43% $18.99 $370.75 001741 Medium Truck Bridgestone M860A 425/65R22.5 20 $1,370.10 43% $37.33 $780.96 244329 Medium Truck Bridgestone M860A 315/80R22.5 20 $1,132.31 43% $61.43 $645.42 000310 Medium Truck Bridgestone R168 215/75R17.5 16 $572.86 43% $12.29 $326.53 241014 Medium Truck Bridgestone R168 425/65R22.5 20 $1,330.75 43% $37.33 $758.53 272914 Medium Truck Bridgestone R180 9R17.5 14 $481.49 43% $5.48 $274.45 240521 Medium Truck Bridgestone R195F 295/75R22.5 14 $753.32 43% $25.23 $429.39 290920 Medium Truck Bridgestone R196 11R22.5 14 $796.16 43% $25.23 $453.81 290939 Medium Truck Bridgestone R196 11R24.5 14 $868.74 43% $29.39 $495.18 296325 Medium Truck Bridgestone R196 295/75R22.5 14 $796.16 43% $25.23 $453.81 296333 Medium Truck Bridgestone R196 285/75R24.5 14 $868.74 43% $25.23 $495.18 000323 Medium Truck Bridgestone R197 ECOPIA 255/70R22.5 16 $614.81 43% $18.99 $350.44 238804 Medium Truck Bridgestone R197 ECOPIA 295/75R22.5 14 $720.99 43% $25.23 $410.96 238838 Medium Truck Bridgestone R197 ECOPIA 285/75R24.5 14 $768.53 43% $25.23 $438.06 238855 Medium Truck Bridgestone R197 ECOPIA 11R22.5 14 $720.99 43% $25.23 $410.96 238872 Medium Truck Bridgestone R197 ECOPIA 11R24.5 14 $768.53 43% $29.39 $438.06 158135 Medium Truck Bridgestone R227 285/70R19.5 16 $777.99 43% $27.31 $443.45 158948 Medium Truck Bridgestone R227 305/70R19.5 18 $969.91 43% $32.51 $552.85 000279 Medium Truck Bridgestone R238 265/70R19.5 14 $664.53 43% $18.99 $378.78 000283 Medium Truck Bridgestone R238 215/75R17.5 14 $482.32 43% $2.36 $274.92 003887 Medium Truck Bridgestone R238 215/75R17.5 16 $496.79 43% $12.29 $283.17 004085 Medium Truck Bridgestone R238 245/70R17.5 18 $513.35 43% $23.63 $292.61 248664 Medium Truck Bridgestone R238 225/70R19.5 12 $521.08 43% $1.32 $297.02 248681 Medium Truck Bridgestone R238 225/70R19.5 14 $535.91 43% $4.44 $305.47 248698 Medium Truck Bridgestone R238 245/70R19.5 14 $561.26 43% $9.83 $319.92 248715 Medium Truck Bridgestone R238 245/70R19.5 16 $578.63 43% $13.61 $329.82 248732 Medium Truck Bridgestone R238 245/70R19.5 12 $544.42 43% $5.48 $310.32 225221 Medium Truck Bridgestone R244 425/65R22.5 20 $1,329.47 43% $37.33 $757.80 225238 Medium Truck Bridgestone R244 385/65R22.5 20 $1,188.17 43% $30.33 $677.26 233687 Medium Truck Bridgestone R244 445/65R22.5 22 $1,457.92 43% $43.94 $831.01 004169 Medium Truck Bridgestone R249 315/80R22.5 20 $867.93 43% $52.83 $494.72 Page 4 of 5683 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 206973 Medium Truck Bridgestone R250ED 11R22.5 16 $837.94 43% $29.39 $477.63 206990 Medium Truck Bridgestone R250ED 11R24.5 16 $879.95 43% $34.59 $501.57 207007 Medium Truck Bridgestone R250ED 11R24.5 16 $906.04 43% $34.59 $516.44 207024 Medium Truck Bridgestone R250ED 11R22.5 16 $843.23 43% $29.39 $480.64 216568 Medium Truck Bridgestone R250ED 255/70R22.5 16 $802.91 NET $18.99 $338.14 216585 Medium Truck Bridgestone R250ED 275/70R22.5 18 $919.47 43% $33.08 $524.10 153028 Medium Truck Bridgestone R250F 225/70R19.5 12 $521.08 43% $1.32 $297.02 000275 Medium Truck Bridgestone R268 ECOPIA 9R22.5 12 $626.62 43% $9.83 $357.17 000276 Medium Truck Bridgestone R268 ECOPIA 10R22.5 12 $687.83 NET $16.07 $345.96 000277 Medium Truck Bridgestone R268 ECOPIA 10R22.5 14 $698.96 NET $20.60 $363.26 000278 Medium Truck Bridgestone R268 ECOPIA 12R22.5 16 $903.59 43% $36.76 $515.05 000280 Medium Truck Bridgestone R268 ECOPIA 245/75R22.5 14 $676.80 43% $11.06 $385.78 000281 Medium Truck Bridgestone R268 ECOPIA 265/75R22.5 14 $748.78 43% $16.07 $426.80 000282 Medium Truck Bridgestone R268 ECOPIA 295/80R22.5 16 $863.39 43% $40.92 $492.13 002920 Medium Truck Bridgestone R268 ECOPIA 295/75R22.5 16 $785.72 NET $34.59 $417.88 241592 Medium Truck Bridgestone R268 ECOPIA 295/75R22.5 14 $764.06 NET $25.23 $386.92 248749 Medium Truck Bridgestone R268 ECOPIA 285/75R24.5 14 $814.62 43% $25.23 $464.33 248783 Medium Truck Bridgestone R268 ECOPIA 11R22.5 14 $764.06 NET $25.23 $396.92 248817 Medium Truck Bridgestone R268 ECOPIA 11R22.5 16 $785.72 NET $29.39 $417.88 248834 Medium Truck Bridgestone R268 ECOPIA 11R24.5 14 $814.62 43% $29.39 $464.33 248868 Medium Truck Bridgestone R268 ECOPIA 11R24.5 16 $837.80 43% $34.59 $477.55 004100 Medium Truck Bridgestone R283A ECOPIA 295/75R22.5 14 $817.70 43% $25.23 $466.09 004101 Medium Truck Bridgestone R283A ECOPIA 295/75R22.5 16 $840.94 43% $34.59 $479.34 004102 Medium Truck Bridgestone R283A ECOPIA 285/75R24.5 14 $871.92 43% $25.23 $496.99 004103 Medium Truck Bridgestone R283A ECOPIA 285/75R24.5 16 $896.79 43% $31.00 $511.17 004104 Medium Truck Bridgestone R283A ECOPIA 11R22.5 14 $817.70 43% $25.23 $466.09 004105 Medium Truck Bridgestone R283A ECOPIA 11R22.5 16 $840.94 43% $29.39 $479.34 004106 Medium Truck Bridgestone R283A ECOPIA 11R24.5 14 $871.92 43% $29.39 $496.99 004107 Medium Truck Bridgestone R283A ECOPIA 11R24.5 16 $896.79 43% $31.00 $511.17 008829 Medium Truck Bridgestone R283S ECOPIA 295/75R22.5 16 $840.94 43% $34.59 $479.34 008830 Medium Truck Bridgestone R283S ECOPIA 285/75R24.5 16 $896.79 43% $31.00 $511.17 008831 Medium Truck Bridgestone R283S ECOPIA 11R22.5 16 $840.94 43% $29.39 $479.34 008832 Medium Truck Bridgestone R283S ECOPIA 11R24.5 16 $896.79 43% $34.59 $511.17 157147 Medium Truck Firestone T819 315/80R22.5 20 $786.86 40% $52.83 $472.12 157341 Medium Truck Firestone T819 12R22.5 16 $669.94 40% $36.76 $401.96 157368 Medium Truck Firestone T819 12R24.5 16 $697.89 40% $40.92 $418.73 294535 Medium Truck Firestone T819 11R22.5 16 $586.42 40% $29.39 $351.85 294543 Medium Truck Firestone T819 11R24.5 16 $625.62 40% $34.59 $375.37 281557 Medium Truck Firestone T831 11R22.5 16 $709.66 NET $29.39 $400.40 281565 Medium Truck Firestone T831 11R24.5 16 $757.44 40% $34.59 $454.46 281581 Medium Truck Firestone T831 12R22.5 16 $812.06 40% $36.76 $487.24 202434 Medium Truck Bridgestone V-STEEL RIB 294 305/75R24.5 18 $1,215.04 43% $0.00 $692.57 117615 Passenger Firestone AFFINITY TOURING P185/65R14 $83.37 20% $0.00 $66.69 141347 Passenger Firestone AFFINITY TOURING P195/70R14 $78.19 20% $0.00 $62.55 000240 Passenger Firestone AFFINITY TOURING S4 FF P195/65R15 $89.94 20% $0.00 $71.95 013873 Passenger Firestone AFFINITY TOURING S4 FF 205/65R16 $108.52 20% $0.00 $86.81 131657 Passenger Firestone AFFINITY TOURING S4 FF P205/65R16 $104.35 20% $0.00 $83.48 043716 Passenger Firestone AFFINITY TOURING T4 P215/60R17 $145.62 20% $0.00 $116.49 004741 Passenger Bridgestone ALENZA 001 225/60R18 XL $236.10 20% $0.00 $188.89 004745 Passenger Bridgestone ALENZA 001 245/50R19 XL $312.71 20% $0.00 $250.17 004742 Passenger Bridgestone ALENZA 001 RFT 225/60R18 XL $246.40 20% $0.00 $197.12 004746 Passenger Bridgestone ALENZA 001 RFT 245/50R19 XL $314.67 20% $0.00 $251.74 004749 Passenger Bridgestone ALENZA 001 RFT 245/45R20 XL $334.31 20% $0.00 $267.45 004750 Passenger Bridgestone ALENZA 001 RFT 275/40R20 XL $362.33 20% $0.00 $289.87 007275 Passenger Bridgestone ALENZA 001 RFT 245/40R21 XL $368.58 20% $0.00 $294.86 007276 Passenger Bridgestone ALENZA 001 RFT 275/35R21 XL $399.47 20% $0.00 $319.58 003019 Passenger Firestone ALL SEASON 225/65R17 $106.54 NET $0.00 $79.37 003024 Passenger Firestone ALL SEASON P235/70R16 $120.65 20% $0.00 $96.52 003030 Passenger Firestone ALL SEASON 235/55R18 $145.42 20% $0.00 $116.34 003034 Passenger Firestone ALL SEASON 235/65R17 $130.29 20% $0.00 $104.23 003036 Passenger Firestone ALL SEASON 215/70R16 $95.19 20% $0.00 $76.15 003040 Passenger Firestone ALL SEASON 235/60R18 $155.32 20% $0.00 $124.26 003042 Passenger Firestone ALL SEASON 225/70R16 $113.94 20% $0.00 $91.15 003050 Passenger Firestone ALL SEASON 235/55R19 $155.52 20% $0.00 $124.42 003051 Passenger Firestone ALL SEASON 185/55R16 $86.11 20% $0.00 $68.89 003057 Passenger Firestone ALL SEASON 245/55R18 $130.17 20% $0.00 $104.13 003058 Passenger Firestone ALL SEASON 265/60R18 $149.83 20% $0.00 $119.87 003065 Passenger Firestone ALL SEASON 235/45R18 $145.02 20% $0.00 $116.02 003066 Passenger Firestone ALL SEASON 245/60R18 $171.15 20% $0.00 $136.92 003068 Passenger Firestone ALL SEASON 235/65R18 $148.62 20% $0.00 $118.90 003072 Passenger Firestone ALL SEASON P255/65R18 $154.33 20% $0.00 $123.46 003076 Passenger Firestone ALL SEASON 225/55R18 $129.57 20% $0.00 $103.65 003080 Passenger Firestone ALL SEASON 245/55R19 $155.78 20% $0.00 $124.63 003082 Passenger Firestone ALL SEASON P245/50R20 $185.51 20% $0.00 $148.41 003084 Passenger Firestone ALL SEASON P255/60R19 $145.71 20% $0.00 $116.57 003092 Passenger Firestone ALL SEASON P255/55R20 $156.32 20% $0.00 $125.05 003816 Passenger Firestone ALL SEASON 215/60R16 $94.50 NET $0.00 $75.60 004002 Passenger Firestone ALL SEASON 225/60R16 $95.32 20% $0.00 $76.25 004012 Passenger Firestone ALL SEASON 205/65R15 $80.14 20% $0.00 $64.12 004014 Passenger Firestone ALL SEASON 215/70R15 $79.86 20% $0.00 $63.89 004018 Passenger Firestone ALL SEASON 185/65R15 $73.82 NET $0.00 $59.06 004020 Passenger Firestone ALL SEASON 215/65R16 $91.61 NET $0.00 $73.29 004022 Passenger Firestone ALL SEASON 225/60R17 $108.43 20% $0.00 $86.75 004028 Passenger Firestone ALL SEASON 235/65R16 $99.16 NET $0.00 $79.33 004030 Passenger Firestone ALL SEASON 205/65R16 $91.46 20% $0.00 $73.17 004032 Passenger Firestone ALL SEASON 235/60R17 $118.09 20% $0.00 $94.48 004034 Passenger Firestone ALL SEASON 215/60R17 $102.93 NET $0.00 $70.03 004040 Passenger Firestone ALL SEASON 185/65R14 $73.32 20% $0.00 $58.66 004042 Passenger Firestone ALL SEASON 215/55R16 $106.93 20% $0.00 $85.54 004044 Passenger Firestone ALL SEASON 205/70R15 $76.04 20% $0.00 $60.83 004046 Passenger Firestone ALL SEASON 225/65R16 $94.71 NET $0.00 $70.52 004050 Passenger Firestone ALL SEASON 215/65R17 $99.47 20% $0.00 $79.58 004054 Passenger Firestone ALL SEASON 175/65R15 $73.72 20% $0.00 $58.97 004058 Passenger Firestone ALL SEASON 185/60R15 $77.01 NET $0.00 $61.61 004060 Passenger Firestone ALL SEASON 225/60R18 $126.56 NET $0.00 $69.72 004062 Passenger Firestone ALL SEASON 195/70R14 $73.93 20% $0.00 $59.15 004068 Passenger Firestone ALL SEASON 235/60R16 $99.02 NET $0.00 $79.22 004070 Passenger Firestone ALL SEASON 205/50R16 $96.09 20% $0.00 $76.87 006251 Passenger Firestone ALL SEASON 205/55R16 $93.90 NET $0.00 $64.99 006252 Passenger Firestone ALL SEASON 195/65R15 $76.91 20% $0.00 $61.53 006253 Passenger Firestone ALL SEASON 225/50R17 $125.59 NET $0.00 $86.99 006254 Passenger Firestone ALL SEASON 195/60R15 $79.74 NET $0.00 $63.79 006255 Passenger Firestone ALL SEASON 225/55R17 $124.28 NET $0.00 $83.36 Page 5 of 5684 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 006256 Passenger Firestone ALL SEASON 235/55R17 $128.41 NET $0.00 $102.73 006258 Passenger Firestone ALL SEASON 205/60R16 $89.72 NET $0.00 $59.99 057809 Passenger Bridgestone B340 175/55R15 $149.46 20% $0.00 $119.57 001522 Passenger Bridgestone B380 RFT P225/60R17 $226.36 20% $0.00 $181.09 000406 Passenger Bridgestone BLIZZAK DM-V2 P275/65R18 $277.14 20% $0.00 $221.71 002459 Passenger Bridgestone BLIZZAK DM-V2 P245/50R20 $285.27 20% $0.00 $228.22 003636 Passenger Bridgestone BLIZZAK DM-V2 265/50R19 XL $278.02 20% $0.00 $222.41 004299 Passenger Bridgestone BLIZZAK DM-V2 235/55R17 $226.08 20% $0.00 $180.86 004300 Passenger Bridgestone BLIZZAK DM-V2 225/60R17 $199.08 20% $0.00 $159.27 004301 Passenger Bridgestone BLIZZAK DM-V2 225/60R18 $230.23 20% $0.00 $184.18 004304 Passenger Bridgestone BLIZZAK DM-V2 245/50R18 $270.33 20% $0.00 $216.27 004305 Passenger Bridgestone BLIZZAK DM-V2 P215/65R17 $192.70 20% $0.00 $154.16 004306 Passenger Bridgestone BLIZZAK DM-V2 215/65R16 $186.94 20% $0.00 $149.55 004308 Passenger Bridgestone BLIZZAK DM-V2 225/55R19 $266.66 20% $0.00 $213.33 004309 Passenger Bridgestone BLIZZAK DM-V2 225/55R17 $217.39 20% $0.00 $173.91 004311 Passenger Bridgestone BLIZZAK DM-V2 225/55R18 $228.27 20% $0.00 $182.61 004312 Passenger Bridgestone BLIZZAK DM-V2 P265/75R16 $195.99 20% $0.00 $156.79 015675 Passenger Bridgestone BLIZZAK DM-V2 235/75R15 XL $173.51 20% $0.00 $138.81 015692 Passenger Bridgestone BLIZZAK DM-V2 225/65R17 $189.60 20% $0.00 $151.68 015726 Passenger Bridgestone BLIZZAK DM-V2 235/55R18 $242.12 20% $0.00 $193.70 015743 Passenger Bridgestone BLIZZAK DM-V2 235/65R17 XL $196.47 20% $0.00 $157.18 015760 Passenger Bridgestone BLIZZAK DM-V2 225/70R16 $182.62 20% $0.00 $146.09 015777 Passenger Bridgestone BLIZZAK DM-V2 235/50R18 XL $263.13 20% $0.00 $210.51 015794 Passenger Bridgestone BLIZZAK DM-V2 235/70R16 $192.56 20% $0.00 $154.04 015811 Passenger Bridgestone BLIZZAK DM-V2 235/65R18 $236.92 20% $0.00 $189.53 015828 Passenger Bridgestone BLIZZAK DM-V2 215/70R16 $178.04 20% $0.00 $142.43 015845 Passenger Bridgestone BLIZZAK DM-V2 275/55R20 XL $296.72 20% $0.00 $237.38 015862 Passenger Bridgestone BLIZZAK DM-V2 235/60R18 XL $230.58 20% $0.00 $184.47 015879 Passenger Bridgestone BLIZZAK DM-V2 255/55R18 XL $267.11 20% $0.00 $213.69 015896 Passenger Bridgestone BLIZZAK DM-V2 P255/60R19 $275.83 20% $0.00 $220.67 015913 Passenger Bridgestone BLIZZAK DM-V2 235/55R19 XL $267.10 20% $0.00 $213.68 015947 Passenger Bridgestone BLIZZAK DM-V2 255/50R20 XL $287.13 20% $0.00 $229.71 015964 Passenger Bridgestone BLIZZAK DM-V2 275/45R20 XL $330.76 20% $0.00 $264.61 016015 Passenger Bridgestone BLIZZAK DM-V2 275/40R20 XL $347.29 20% $0.00 $277.83 016032 Passenger Bridgestone BLIZZAK DM-V2 265/50R20 $292.64 20% $0.00 $234.11 016049 Passenger Bridgestone BLIZZAK DM-V2 265/60R18 $266.04 20% $0.00 $212.83 016066 Passenger Bridgestone BLIZZAK DM-V2 255/50R19 XL $278.29 20% $0.00 $222.63 016083 Passenger Bridgestone BLIZZAK DM-V2 245/60R18 $245.20 20% $0.00 $196.16 016100 Passenger Bridgestone BLIZZAK DM-V2 245/70R16 $192.72 20% $0.00 $154.17 016117 Passenger Bridgestone BLIZZAK DM-V2 235/55R20 $243.50 20% $0.00 $194.80 016134 Passenger Bridgestone BLIZZAK DM-V2 P235/70R17 XL $196.08 20% $0.00 $156.87 016151 Passenger Bridgestone BLIZZAK DM-V2 255/55R19 XL $265.04 20% $0.00 $212.03 016168 Passenger Bridgestone BLIZZAK DM-V2 245/65R17 $203.15 20% $0.00 $162.52 016185 Passenger Bridgestone BLIZZAK DM-V2 285/60R18 $289.42 20% $0.00 $231.53 016219 Passenger Bridgestone BLIZZAK DM-V2 255/60R18 XL $263.92 20% $0.00 $211.14 016236 Passenger Bridgestone BLIZZAK DM-V2 P265/65R18 $266.05 20% $0.00 $212.84 016253 Passenger Bridgestone BLIZZAK DM-V2 225/75R16 $167.28 20% $0.00 $133.82 016287 Passenger Bridgestone BLIZZAK DM-V2 275/60R20 $298.50 20% $0.00 $238.80 016304 Passenger Bridgestone BLIZZAK DM-V2 275/60R18 $277.48 20% $0.00 $221.98 016321 Passenger Bridgestone BLIZZAK DM-V2 P285/45R22 $386.66 20% $0.00 $309.33 016338 Passenger Bridgestone BLIZZAK DM-V2 215/70R17 $183.52 20% $0.00 $146.81 016355 Passenger Bridgestone BLIZZAK DM-V2 P245/55R19 $268.82 20% $0.00 $215.05 016372 Passenger Bridgestone BLIZZAK DM-V2 245/70R17 $197.35 20% $0.00 $157.88 016389 Passenger Bridgestone BLIZZAK DM-V2 P255/55R20 $264.21 20% $0.00 $211.36 016406 Passenger Bridgestone BLIZZAK DM-V2 255/70R17 $204.11 20% $0.00 $163.28 016423 Passenger Bridgestone BLIZZAK DM-V2 P255/70R18 $256.42 20% $0.00 $205.14 016457 Passenger Bridgestone BLIZZAK DM-V2 265/70R17 $234.74 20% $0.00 $187.79 016474 Passenger Bridgestone BLIZZAK DM-V2 265/70R18 $267.12 20% $0.00 $213.69 016525 Passenger Bridgestone BLIZZAK DM-V2 245/75R16 $180.13 20% $0.00 $144.10 016542 Passenger Bridgestone BLIZZAK DM-V2 255/70R16 $200.42 20% $0.00 $160.34 016559 Passenger Bridgestone BLIZZAK DM-V2 265/65R17 $237.74 20% $0.00 $190.19 016576 Passenger Bridgestone BLIZZAK DM-V2 265/70R16 $206.30 20% $0.00 $165.04 016593 Passenger Bridgestone BLIZZAK DM-V2 285/50R20 XL $316.52 20% $0.00 $253.22 016610 Passenger Bridgestone BLIZZAK DM-V2 P255/65R18 $255.41 20% $0.00 $204.32 002864 Passenger Bridgestone BLIZZAK LM001 205/55R16 XL $241.52 20% $0.00 $193.21 002866 Passenger Bridgestone BLIZZAK LM001 225/45R17 XL $300.29 20% $0.00 $240.23 002868 Passenger Bridgestone BLIZZAK LM001 225/40R18 XL $328.98 20% $0.00 $263.19 002869 Passenger Bridgestone BLIZZAK LM001 245/40R19 XL $412.62 20% $0.00 $330.09 002871 Passenger Bridgestone BLIZZAK LM001 225/50R17 XL $312.30 20% $0.00 $249.84 002872 Passenger Bridgestone BLIZZAK LM001 245/45R18 XL $369.70 20% $0.00 $295.76 002880 Passenger Bridgestone BLIZZAK LM001 225/45R18 XL $344.02 20% $0.00 $275.21 002885 Passenger Bridgestone BLIZZAK LM001 235/45R18 XL $354.90 20% $0.00 $283.92 002886 Passenger Bridgestone BLIZZAK LM001 255/40R18 XL $370.06 20% $0.00 $296.05 002890 Passenger Bridgestone BLIZZAK LM001 235/45R17 XL $337.16 20% $0.00 $269.72 002896 Passenger Bridgestone BLIZZAK LM001 245/45R17 XL $351.22 20% $0.00 $280.97 002900 Passenger Bridgestone BLIZZAK LM001 255/35R19 XL $466.36 20% $0.00 $373.09 003518 Passenger Bridgestone BLIZZAK LM001 225/60R18 XL $227.33 20% $0.00 $181.86 003522 Passenger Bridgestone BLIZZAK LM001 RFT 225/60R18 XL $227.33 20% $0.00 $181.86 003523 Passenger Bridgestone BLIZZAK LM001 RFT 245/50R19 XL $227.33 20% $0.00 $181.86 005297 Passenger Bridgestone BLIZZAK LM001 RFT 225/55R17 $347.48 20% $0.00 $277.99 005298 Passenger Bridgestone BLIZZAK LM001 RFT 225/50R18 $383.10 20% $0.00 $306.48 007048 Passenger Bridgestone BLIZZAK LM001 RFT 225/50R17 $362.04 20% $0.00 $289.63 006385 Passenger Bridgestone BLIZZAK LM-25 195/60R16 $227.35 20% $0.00 $181.88 127305 Passenger Bridgestone BLIZZAK LM-25 4X4 MOE 255/50R19 XL $553.22 20% $0.00 $442.58 096654 Passenger Bridgestone BLIZZAK LM-25 4X4 RFT 255/50R19 XL $569.83 20% $0.00 $455.86 040248 Passenger Bridgestone BLIZZAK LM-25 RFT 245/45R18 $474.93 20% $0.00 $379.94 071171 Passenger Bridgestone BLIZZAK LM-25 RFT 245/50R17 $416.51 20% $0.00 $333.21 118771 Passenger Bridgestone BLIZZAK LM-25 RFT 255/40RF20 $615.30 20% $0.00 $492.24 118805 Passenger Bridgestone BLIZZAK LM-25 RFT 285/35RF20 $676.83 20% $0.00 $541.47 121933 Passenger Bridgestone BLIZZAK LM-25 RFT 205/55R16 $247.04 20% $0.00 $197.63 132320 Passenger Bridgestone BLIZZAK LM-25 RFT 225/45R17 XL $373.56 20% $0.00 $298.85 132354 Passenger Bridgestone BLIZZAK LM-25 RFT 205/50R17 $301.94 20% $0.00 $241.55 003652 Passenger Bridgestone BLIZZAK LM-25-1 RFT 205/55R17 $316.97 20% $0.00 $253.57 023461 Passenger Bridgestone BLIZZAK LM-25-1 RFT 225/50R17 $362.04 20% $0.00 $289.63 002891 Passenger Bridgestone BLIZZAK LM-32 245/55R18 $351.22 20% $0.00 $280.97 003772 Passenger Bridgestone BLIZZAK LM-32 215/45R20 $404.51 20% $0.00 $323.61 003773 Passenger Bridgestone BLIZZAK LM-32 225/50R17 $292.32 20% $0.00 $233.85 005289 Passenger Bridgestone BLIZZAK LM-32 235/40R19 XL $395.47 20% $0.00 $316.38 019670 Passenger Bridgestone BLIZZAK LM-32 275/40R19 $477.97 20% $0.00 $382.37 023155 Passenger Bridgestone BLIZZAK LM-32 245/40R20 $499.29 20% $0.00 $399.43 023172 Passenger Bridgestone BLIZZAK LM-32 295/35R20 XL $628.69 20% $0.00 $502.96 139018 Passenger Bridgestone BLIZZAK LM-32 215/45R17 XL $284.51 20% $0.00 $227.61 139035 Passenger Bridgestone BLIZZAK LM-32 225/40R19 XL $380.26 20% $0.00 $304.21 Page 6 of 5685 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 139086 Passenger Bridgestone BLIZZAK LM-32 225/50R18 $329.08 20% $0.00 $263.26 139137 Passenger Bridgestone BLIZZAK LM-32 245/45R19 XL $392.97 20% $0.00 $314.38 139171 Passenger Bridgestone BLIZZAK LM-32 255/45R18 XL $384.49 20% $0.00 $307.59 139290 Passenger Bridgestone BLIZZAK LM-32 255/35R20 XL $496.87 20% $0.00 $397.49 139341 Passenger Bridgestone BLIZZAK LM-32 245/45R20 $457.20 20% $0.00 $365.76 139375 Passenger Bridgestone BLIZZAK LM-32 255/40R19 XL $429.12 20% $0.00 $343.30 139409 Passenger Bridgestone BLIZZAK LM-32 275/35R19 $487.32 20% $0.00 $389.86 139426 Passenger Bridgestone BLIZZAK LM-32 275/35R18 $413.59 20% $0.00 $330.87 139494 Passenger Bridgestone BLIZZAK LM-32 225/45R19 XL $362.13 20% $0.00 $289.70 139511 Passenger Bridgestone BLIZZAK LM-32 215/45R18 XL $312.19 20% $0.00 $249.75 139579 Passenger Bridgestone BLIZZAK LM-32 265/35R19 XL $468.58 20% $0.00 $374.87 003777 Passenger Bridgestone BLIZZAK LM-32 EXT 225/50R17 $360.31 20% $0.00 $288.25 000450 Passenger Bridgestone BLIZZAK LM-32 MOE 255/40R18 XL $444.72 20% $0.00 $355.78 059424 Passenger Bridgestone BLIZZAK LM-50 RFT P225/60R17 $233.86 20% $0.00 $187.09 001626 Passenger Bridgestone BLIZZAK LM-500 155/70R19 $188.21 20% $0.00 $150.57 131487 Passenger Bridgestone BLIZZAK LM-60 RFT 195/55R16 $239.32 20% $0.00 $191.46 131538 Passenger Bridgestone BLIZZAK LM-60 RFT 205/45R17 $274.05 20% $0.00 $219.24 131759 Passenger Bridgestone BLIZZAK LM-60 RFT 255/55R18 XL $439.74 20% $0.00 $351.80 131827 Passenger Bridgestone BLIZZAK LM-60 RFT 225/40R18 $365.54 20% $0.00 $292.43 141891 Passenger Bridgestone BLIZZAK LM-60 RFT P235/55R18 $391.09 20% $0.00 $312.87 139477 Passenger Bridgestone BLIZZAK LM-80 255/50R19 XL $398.96 20% $0.00 $319.16 139392 Passenger Bridgestone BLIZZAK LM-80 EVO 235/55R17 $306.29 20% $0.00 $245.03 139936 Passenger Bridgestone BLIZZAK LM-80 EVO 235/50R18 $340.55 20% $0.00 $272.44 000646 Passenger Bridgestone BLIZZAK LM-80 RFT P225/65RF17 $267.82 20% $0.00 $214.26 112569 Passenger Bridgestone BLIZZAK MZ03 RFT 245/40R18 $343.86 20% $0.00 $275.08 080589 Passenger Bridgestone BLIZZAK WS60 185/65R14 $140.18 20% $0.00 $112.15 080776 Passenger Bridgestone BLIZZAK WS60 225/55R16 $233.66 20% $0.00 $186.93 080946 Passenger Bridgestone BLIZZAK WS60 205/60R15 $160.47 20% $0.00 $128.38 105834 Passenger Bridgestone BLIZZAK WS70 195/60R15 $153.07 20% $0.00 $122.45 001206 Passenger Bridgestone BLIZZAK WS80 235/50R19 $316.74 20% $0.00 $253.39 001377 Passenger Bridgestone BLIZZAK WS80 235/60R16 $204.73 20% $0.00 $163.79 002460 Passenger Bridgestone BLIZZAK WS80 195/50R16 $209.44 20% $0.00 $167.55 013006 Passenger Bridgestone BLIZZAK WS80 205/55R16 $219.56 20% $0.00 $175.65 013023 Passenger Bridgestone BLIZZAK WS80 215/60R16 $187.52 20% $0.00 $150.02 013040 Passenger Bridgestone BLIZZAK WS80 195/65R15 $157.63 20% $0.00 $126.11 013057 Passenger Bridgestone BLIZZAK WS80 205/60R16 $178.28 20% $0.00 $142.62 013074 Passenger Bridgestone BLIZZAK WS80 185/65R15 $150.09 20% $0.00 $120.07 013091 Passenger Bridgestone BLIZZAK WS80 225/50R17 $291.87 20% $0.00 $233.50 013108 Passenger Bridgestone BLIZZAK WS80 215/55R17 $236.42 20% $0.00 $189.13 013125 Passenger Bridgestone BLIZZAK WS80 225/45R17 $286.73 20% $0.00 $229.39 013142 Passenger Bridgestone BLIZZAK WS80 235/55R17 $253.52 20% $0.00 $202.82 013159 Passenger Bridgestone BLIZZAK WS80 225/55R17 $243.77 20% $0.00 $195.01 013176 Passenger Bridgestone BLIZZAK WS80 235/65R16 $205.00 20% $0.00 $164.00 013193 Passenger Bridgestone BLIZZAK WS80 225/60R17 $212.48 20% $0.00 $169.99 013210 Passenger Bridgestone BLIZZAK WS80 235/45R17 XL $310.28 20% $0.00 $248.22 013227 Passenger Bridgestone BLIZZAK WS80 215/50R17 XL $281.63 20% $0.00 $225.31 013244 Passenger Bridgestone BLIZZAK WS80 225/65R17 $210.33 20% $0.00 $168.26 013261 Passenger Bridgestone BLIZZAK WS80 215/60R17 $204.32 20% $0.00 $163.46 013278 Passenger Bridgestone BLIZZAK WS80 205/50R17 XL $238.29 20% $0.00 $190.63 013295 Passenger Bridgestone BLIZZAK WS80 215/45R17 XL $263.70 20% $0.00 $210.96 013312 Passenger Bridgestone BLIZZAK WS80 215/65R17 $202.25 20% $0.00 $161.80 013363 Passenger Bridgestone BLIZZAK WS80 225/40R18 XL $270.47 20% $0.00 $216.38 013380 Passenger Bridgestone BLIZZAK WS80 225/60R18 $260.08 20% $0.00 $208.07 013397 Passenger Bridgestone BLIZZAK WS80 245/40R18 XL $292.98 20% $0.00 $234.38 013414 Passenger Bridgestone BLIZZAK WS80 225/65R16 $193.85 20% $0.00 $155.08 013431 Passenger Bridgestone BLIZZAK WS80 235/50R18 XL $301.66 20% $0.00 $241.33 013448 Passenger Bridgestone BLIZZAK WS80 195/55R16 $218.18 20% $0.00 $174.54 013465 Passenger Bridgestone BLIZZAK WS80 225/50R18 $289.59 20% $0.00 $231.67 013482 Passenger Bridgestone BLIZZAK WS80 255/35R18 $310.82 20% $0.00 $248.65 013499 Passenger Bridgestone BLIZZAK WS80 215/55R18 $289.60 20% $0.00 $231.68 013516 Passenger Bridgestone BLIZZAK WS80 205/40R17 XL $238.62 20% $0.00 $190.89 013533 Passenger Bridgestone BLIZZAK WS80 205/65R15 $169.28 20% $0.00 $135.43 013550 Passenger Bridgestone BLIZZAK WS80 195/60R16 $171.15 20% $0.00 $136.92 013567 Passenger Bridgestone BLIZZAK WS80 215/70R15 $158.56 20% $0.00 $126.85 013584 Passenger Bridgestone BLIZZAK WS80 215/65R16 $186.38 20% $0.00 $149.11 013601 Passenger Bridgestone BLIZZAK WS80 215/55R16 XL $226.61 20% $0.00 $181.29 013618 Passenger Bridgestone BLIZZAK WS80 185/60R15 $158.88 20% $0.00 $127.10 013635 Passenger Bridgestone BLIZZAK WS80 235/65R17 $218.74 20% $0.00 $174.99 013652 Passenger Bridgestone BLIZZAK WS80 245/45R17 XL $316.41 20% $0.00 $253.13 013669 Passenger Bridgestone BLIZZAK WS80 235/60R17 $220.99 20% $0.00 $176.79 013686 Passenger Bridgestone BLIZZAK WS80 225/45R18 XL $280.09 20% $0.00 $224.07 013703 Passenger Bridgestone BLIZZAK WS80 225/55R18 $301.66 20% $0.00 $241.33 013720 Passenger Bridgestone BLIZZAK WS80 235/40R18 XL $291.60 20% $0.00 $233.28 013737 Passenger Bridgestone BLIZZAK WS80 205/65R16 $188.69 20% $0.00 $150.95 013754 Passenger Bridgestone BLIZZAK WS80 175/65R15 $143.01 20% $0.00 $114.41 013771 Passenger Bridgestone BLIZZAK WS80 245/50R18 XL $326.81 20% $0.00 $261.45 013788 Passenger Bridgestone BLIZZAK WS80 185/55R15 $163.64 20% $0.00 $130.91 013805 Passenger Bridgestone BLIZZAK WS80 185/55R16 XL $209.43 20% $0.00 $167.55 013822 Passenger Bridgestone BLIZZAK WS80 225/60R16 $196.85 20% $0.00 $157.48 000107 Passenger Firestone CHAMPION FUEL FIGHTER 195/50R16 $101.01 NET $0.00 $73.83 001814 Passenger Firestone CHAMPION FUEL FIGHTER 235/45R18 $168.76 NET $0.00 $103.51 014791 Passenger Firestone CHAMPION FUEL FIGHTER 185/60R15 $73.34 20% $0.00 $58.67 014808 Passenger Firestone CHAMPION FUEL FIGHTER 205/70R15 $73.78 20% $0.00 $59.02 014825 Passenger Firestone CHAMPION FUEL FIGHTER 215/60R17 $113.17 20% $0.00 $90.53 014859 Passenger Firestone CHAMPION FUEL FIGHTER 215/65R16 $88.77 20% $0.00 $71.01 014876 Passenger Firestone CHAMPION FUEL FIGHTER 215/65R17 $101.68 NET $0.00 $77.37 014910 Passenger Firestone CHAMPION FUEL FIGHTER 215/70R15 $77.76 20% $0.00 $62.21 014927 Passenger Firestone CHAMPION FUEL FIGHTER 225/50R18 $129.05 NET $0.00 $86.56 014944 Passenger Firestone CHAMPION FUEL FIGHTER 225/65R17 $109.03 20% $0.00 $87.22 014961 Passenger Firestone CHAMPION FUEL FIGHTER 225/70R16 $108.23 NET $0.00 $81.59 014978 Passenger Firestone CHAMPION FUEL FIGHTER 235/60R16 $100.21 20% $0.00 $80.17 014995 Passenger Firestone CHAMPION FUEL FIGHTER 235/65R16 $96.01 20% $0.00 $76.81 015012 Passenger Firestone CHAMPION FUEL FIGHTER 235/65R17 $112.31 NET $0.00 $88.29 015029 Passenger Firestone CHAMPION FUEL FIGHTER 215/60R16 $94.94 20% $0.00 $75.95 015046 Passenger Firestone CHAMPION FUEL FIGHTER 175/65R15 $74.69 20% $0.00 $59.75 015063 Passenger Firestone CHAMPION FUEL FIGHTER 185/60R14 $71.71 20% $0.00 $57.36 015080 Passenger Firestone CHAMPION FUEL FIGHTER 185/65R15 $71.88 20% $0.00 $57.51 015097 Passenger Firestone CHAMPION FUEL FIGHTER 195/55R16 $99.04 NET $0.00 $79.23 015114 Passenger Firestone CHAMPION FUEL FIGHTER 195/60R15 $74.82 20% $0.00 $59.85 015131 Passenger Firestone CHAMPION FUEL FIGHTER 195/65R15 $74.87 20% $0.00 $59.90 015148 Passenger Firestone CHAMPION FUEL FIGHTER 205/55R16 $96.35 NET $0.00 $72.30 015165 Passenger Firestone CHAMPION FUEL FIGHTER 205/60R15 $79.84 20% $0.00 $63.87 015182 Passenger Firestone CHAMPION FUEL FIGHTER 205/60R16 $91.64 20% $0.00 $73.31 Page 7 of 5686 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 015199 Passenger Firestone CHAMPION FUEL FIGHTER 205/65R15 $78.17 20% $0.00 $62.54 015216 Passenger Firestone CHAMPION FUEL FIGHTER 215/55R18 $125.06 NET $0.00 $83.05 015233 Passenger Firestone CHAMPION FUEL FIGHTER 215/60R15 $84.48 20% $0.00 $67.58 015284 Passenger Firestone CHAMPION FUEL FIGHTER 225/60R17 $111.47 NET $0.00 $89.18 015301 Passenger Firestone CHAMPION FUEL FIGHTER 225/60R18 $124.07 NET $0.00 $74.70 015335 Passenger Firestone CHAMPION FUEL FIGHTER 225/65R16 $92.33 20% $0.00 $73.86 015352 Passenger Firestone CHAMPION FUEL FIGHTER 235/60R17 $114.89 NET $0.00 $86.87 015369 Passenger Firestone CHAMPION FUEL FIGHTER 215/60R16 $101.70 20% $0.00 $81.36 015386 Passenger Firestone CHAMPION FUEL FIGHTER 185/55R15 $87.94 20% $0.00 $70.35 015403 Passenger Firestone CHAMPION FUEL FIGHTER 195/55R15 $83.28 20% $0.00 $66.62 015420 Passenger Firestone CHAMPION FUEL FIGHTER 205/50R16 $104.07 NET $0.00 $76.77 015437 Passenger Firestone CHAMPION FUEL FIGHTER 205/50R17 $124.64 NET $0.00 $85.48 015454 Passenger Firestone CHAMPION FUEL FIGHTER 215/45R17 $125.80 NET $0.00 $92.51 015471 Passenger Firestone CHAMPION FUEL FIGHTER 215/50R17 XL $140.95 NET $0.00 $91.43 015488 Passenger Firestone CHAMPION FUEL FIGHTER 215/55R16 $101.28 NET $0.00 $80.34 015505 Passenger Firestone CHAMPION FUEL FIGHTER 215/55R17 $117.23 NET $0.00 $80.09 015522 Passenger Firestone CHAMPION FUEL FIGHTER 225/45R17 $123.14 NET $0.00 $86.23 015539 Passenger Firestone CHAMPION FUEL FIGHTER 225/45R18 XL $153.55 NET $0.00 $103.18 015556 Passenger Firestone CHAMPION FUEL FIGHTER 225/50R17 $147.78 NET $0.00 $91.72 015590 Passenger Firestone CHAMPION FUEL FIGHTER 225/55R17 $127.91 NET $0.00 $92.22 015607 Passenger Firestone CHAMPION FUEL FIGHTER 225/60R16 $96.36 20% $0.00 $77.08 015624 Passenger Firestone CHAMPION FUEL FIGHTER 235/45R17 XL $147.04 NET $0.00 $93.93 015641 Passenger Firestone CHAMPION FUEL FIGHTER 235/55R17 $130.14 NET $0.00 $97.49 015658 Passenger Firestone CHAMPION FUEL FIGHTER 235/55R18 $154.99 NET $0.00 $89.84 023240 Passenger Firestone CHAMPION FUEL FIGHTER 205/65R16 $95.44 20% $0.00 $76.35 003345 Passenger Firestone DESTINATION A/T P245/65R17 $239.19 NET $0.00 $108.73 003471 Passenger Firestone DESTINATION A/T P265/70R17 $240.85 NET $0.00 $131.87 003480 Passenger Firestone DESTINATION A/T P235/75R17 $216.81 NET $0.00 $115.16 017885 Passenger Firestone DESTINATION A/T P245/65R17 $239.19 NET $0.00 $108.73 017902 Passenger Firestone DESTINATION A/T P265/70R16 $221.22 NET $0.00 $129.26 017919 Passenger Firestone DESTINATION A/T P265/75R16 $212.80 NET $0.00 $127.72 026495 Passenger Firestone DESTINATION A/T P205/75R15 $151.43 NET $0.00 $94.91 026512 Passenger Firestone DESTINATION A/T P215/75R15 $157.36 NET $0.00 $91.13 026546 Passenger Firestone DESTINATION A/T P225/75R15 $170.15 NET $0.00 $99.04 026563 Passenger Firestone DESTINATION A/T P235/75R15 $179.11 NET $0.00 $104.94 026614 Passenger Firestone DESTINATION A/T P245/75R16 $196.83 NET $0.00 $137.76 026716 Passenger Firestone DESTINATION A/T P235/70R15 $183.39 NET $0.00 $101.46 026767 Passenger Firestone DESTINATION A/T P235/70R16 $188.18 NET $0.00 $119.33 026784 Passenger Firestone DESTINATION A/T P265/70R17 $240.85 NET $0.00 $131.87 026869 Passenger Firestone DESTINATION A/T P255/70R16 $208.80 NET $0.00 $119.64 027379 Passenger Firestone DESTINATION A/T P235/75R16 $186.73 NET $0.00 $104.38 027430 Passenger Firestone DESTINATION A/T P245/70R16 $197.03 NET $0.00 $133.73 054239 Passenger Firestone DESTINATION A/T P235/75R17 $216.81 NET $0.00 $115.16 054273 Passenger Firestone DESTINATION A/T P245/70R17 $220.25 NET $0.00 $118.28 054290 Passenger Firestone DESTINATION A/T P255/70R17 $227.76 NET $0.00 $124.60 054307 Passenger Firestone DESTINATION A/T P255/65R17 $255.01 NET $0.00 $114.84 054324 Passenger Firestone DESTINATION A/T P275/65R18 $287.63 NET $0.00 $133.83 066139 Passenger Firestone DESTINATION A/T P285/70R17 $255.50 NET $0.00 $131.22 066156 Passenger Firestone DESTINATION A/T P265/65R17 $263.74 NET $0.00 $120.24 077546 Passenger Firestone DESTINATION A/T P265/70R18 $261.38 NET $0.00 $134.91 077563 Passenger Firestone DESTINATION A/T P245/75R17 $225.47 NET $0.00 $119.32 094869 Passenger Firestone DESTINATION A/T P235/70R17 XL $220.44 NET $0.00 $108.89 108826 Passenger Firestone DESTINATION A/T P235/65R17 $232.03 NET $0.00 $105.41 108843 Passenger Firestone DESTINATION A/T P255/70R18 $251.36 NET $0.00 $129.00 108860 Passenger Firestone DESTINATION A/T P255/75R17 $234.49 NET $0.00 $132.58 108877 Passenger Firestone DESTINATION A/T P265/60R18 $280.76 NET $0.00 $127.54 108894 Passenger Firestone DESTINATION A/T P275/60R20 $297.11 NET $0.00 $143.54 108911 Passenger Firestone DESTINATION A/T P275/55R20 $307.14 NET $0.00 $139.70 123310 Passenger Firestone DESTINATION A/T P265/65R18 $276.12 NET $0.00 $129.87 090177 Passenger Firestone DESTINATION LE P265/65R18 $224.67 20% $0.00 $179.73 112379 Passenger Firestone DESTINATION LE P235/60R17 $203.30 20% $0.00 $162.63 000223 Passenger Firestone DESTINATION LE 2 P245/75R16 $169.93 20% $0.00 $135.94 000224 Passenger Firestone DESTINATION LE 2 P265/65R17 $228.10 20% $0.00 $182.47 002011 Passenger Firestone DESTINATION LE 2 P255/65R18 $230.53 20% $0.00 $184.42 002012 Passenger Firestone DESTINATION LE 2 255/55R18 XL $267.50 20% $0.00 $213.99 002013 Passenger Firestone DESTINATION LE 2 255/50R19 XL $283.53 20% $0.00 $226.81 002014 Passenger Firestone DESTINATION LE 2 255/55R19 XL $280.18 20% $0.00 $224.14 002016 Passenger Firestone DESTINATION LE 2 P255/60R19 $255.40 20% $0.00 $204.31 002017 Passenger Firestone DESTINATION LE 2 255/50R20 XL $309.71 20% $0.00 $247.76 002018 Passenger Firestone DESTINATION LE 2 265/50R20 $310.80 20% $0.00 $248.63 002019 Passenger Firestone DESTINATION LE 2 P285/45R22 $365.33 20% $0.00 $292.25 002020 Passenger Firestone DESTINATION LE 2 P235/55R19 $240.56 20% $0.00 $192.44 002021 Passenger Firestone DESTINATION LE 2 P205/70R16 $153.81 20% $0.00 $123.04 002022 Passenger Firestone DESTINATION LE 2 235/50R19 $262.32 20% $0.00 $209.85 002023 Passenger Firestone DESTINATION LE 2 P245/50R20 $286.89 20% $0.00 $229.50 002025 Passenger Firestone DESTINATION LE 2 275/45R20 XL $351.30 20% $0.00 $281.03 002026 Passenger Firestone DESTINATION LE 2 235/50R18 $249.15 20% $0.00 $199.31 002027 Passenger Firestone DESTINATION LE 2 275/55R19 $281.13 20% $0.00 $224.90 002090 Passenger Firestone DESTINATION LE 2 P235/55R20 $263.47 20% $0.00 $210.77 002091 Passenger Firestone DESTINATION LE 2 P255/55R20 $274.00 20% $0.00 $219.19 002360 Passenger Firestone DESTINATION LE 2 245/60R18 $245.79 20% $0.00 $196.63 003351 Passenger Firestone DESTINATION LE 2 225/60R17 $202.85 20% $0.00 $162.27 003352 Passenger Firestone DESTINATION LE 2 225/65R17 $193.24 20% $0.00 $154.59 006239 Passenger Firestone DESTINATION LE 2 225/55R18 $227.30 20% $0.00 $181.83 006241 Passenger Firestone DESTINATION LE 2 215/65R17 $185.05 20% $0.00 $148.03 006243 Passenger Firestone DESTINATION LE 2 215/65R16 $175.21 20% $0.00 $140.17 006244 Passenger Firestone DESTINATION LE 2 235/55R17 $230.45 20% $0.00 $184.36 006245 Passenger Firestone DESTINATION LE 2 225/60R18 $215.91 20% $0.00 $172.72 006246 Passenger Firestone DESTINATION LE 2 225/55R19 $230.93 20% $0.00 $184.74 006247 Passenger Firestone DESTINATION LE 2 235/45R19 $265.19 20% $0.00 $212.15 006249 Passenger Firestone DESTINATION LE 2 215/60R17 $202.59 20% $0.00 $162.07 006250 Passenger Firestone DESTINATION LE 2 245/60R20 $258.86 20% $0.00 $207.08 006513 Passenger Firestone DESTINATION LE 2 P265/65R17 $228.10 20% $0.00 $182.47 006777 Passenger Firestone DESTINATION LE 2 225/60R17 $202.91 20% $0.00 $162.32 017936 Passenger Firestone DESTINATION LE 2 P235/65R16 $196.22 NET $0.00 $95.42 017970 Passenger Firestone DESTINATION LE 2 P245/60R18 $245.79 NET $0.00 $101.03 017987 Passenger Firestone DESTINATION LE 2 P235/60R17 $219.48 20% $0.00 $175.58 018004 Passenger Firestone DESTINATION LE 2 P265/65R18 $235.97 NET $0.00 $120.37 024991 Passenger Firestone DESTINATION LE 2 225/60R17 $202.91 NET $0.00 $82.37 025008 Passenger Firestone DESTINATION LE 2 225/65R17 $193.24 NET $0.00 $98.58 097606 Passenger Firestone DESTINATION LE 2 P225/75R16 $165.07 NET $0.00 $98.49 097623 Passenger Firestone DESTINATION LE 2 P235/75R15 XL $161.52 NET $0.00 $100.91 097657 Passenger Firestone DESTINATION LE 2 P245/75R16 $178.93 NET $0.00 $116.59 Page 8 of 5687 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 097674 Passenger Firestone DESTINATION LE 2 P265/75R15 $182.50 NET $0.00 $116.56 097708 Passenger Firestone DESTINATION LE 2 P265/75R16 $186.50 NET $0.00 $118.25 097725 Passenger Firestone DESTINATION LE 2 P215/70R16 $166.88 NET $0.00 $89.21 097742 Passenger Firestone DESTINATION LE 2 225/70R16 $177.32 NET $0.00 $98.01 097759 Passenger Firestone DESTINATION LE 2 P235/70R16 XL $180.24 NET $0.00 $107.49 097776 Passenger Firestone DESTINATION LE 2 P235/70R17 XL $206.63 NET $0.00 $106.02 097793 Passenger Firestone DESTINATION LE 2 P245/70R16 $184.09 NET $0.00 $101.78 097827 Passenger Firestone DESTINATION LE 2 P245/70R17 $202.03 NET $0.00 $103.35 097844 Passenger Firestone DESTINATION LE 2 P255/70R16 $185.77 NET $0.00 $114.11 097878 Passenger Firestone DESTINATION LE 2 P255/70R18 $231.46 NET $0.00 $117.49 097895 Passenger Firestone DESTINATION LE 2 P265/70R16 $196.82 NET $0.00 $114.55 097912 Passenger Firestone DESTINATION LE 2 P265/70R17 $222.94 NET $0.00 $117.36 097929 Passenger Firestone DESTINATION LE 2 P265/70R18 $241.09 NET $0.00 $122.95 097946 Passenger Firestone DESTINATION LE 2 225/65R17 $203.45 NET $0.00 $88.19 097963 Passenger Firestone DESTINATION LE 2 235/65R17 $214.11 NET $0.00 $94.00 097980 Passenger Firestone DESTINATION LE 2 P235/65R18 $222.03 NET $0.00 $96.38 097997 Passenger Firestone DESTINATION LE 2 P245/65R17 $213.30 NET $0.00 $98.27 098031 Passenger Firestone DESTINATION LE 2 P255/65R16 $214.80 NET $0.00 $101.91 098048 Passenger Firestone DESTINATION LE 2 P255/65R17 $229.65 NET $0.00 $109.87 098065 Passenger Firestone DESTINATION LE 2 P265/65R17 $237.60 NET $0.00 $111.06 098099 Passenger Firestone DESTINATION LE 2 P265/60R18 $262.65 NET $0.00 $118.46 098133 Passenger Firestone DESTINATION LE 2 P275/60R17 $255.28 NET $0.00 $115.59 098150 Passenger Firestone DESTINATION LE 2 P235/55R18 $238.97 NET $0.00 $101.69 136043 Passenger Firestone DESTINATION LE 2 P255/70R17 $216.53 NET $0.00 $118.59 136060 Passenger Firestone DESTINATION LE 2 P275/65R18 $262.96 NET $0.00 $125.38 136094 Passenger Firestone DESTINATION LE 2 P235/60R18 $232.01 NET $0.00 $98.72 136128 Passenger Firestone DESTINATION LE 2 P245/55R19 $240.93 NET $0.00 $104.19 136145 Passenger Firestone DESTINATION LE 2 P275/60R20 $275.37 NET $0.00 $126.95 136162 Passenger Firestone DESTINATION LE 2 P275/55R20 $282.04 NET $0.00 $120.00 140310 Passenger Firestone DESTINATION LE 2 P215/75R15 $151.63 NET $0.00 $84.71 140327 Passenger Firestone DESTINATION LE 2 P225/75R15 $157.49 NET $0.00 $93.47 140344 Passenger Firestone DESTINATION LE 2 P225/70R15 $162.93 NET $0.00 $91.53 140361 Passenger Firestone DESTINATION LE 2 P235/70R15 $166.66 NET $0.00 $91.76 140378 Passenger Firestone DESTINATION LE 2 P235/75R16 XL $171.96 NET $0.00 $105.82 001218 Passenger Bridgestone DRIVEGUARD 235/60RF17 $226.48 20% $0.00 $181.19 001219 Passenger Bridgestone DRIVEGUARD 235/65RF17 $226.15 20% $0.00 $180.92 001220 Passenger Bridgestone DRIVEGUARD 235/65RF16 $200.92 20% $0.00 $160.74 001221 Passenger Bridgestone DRIVEGUARD 225/65RF17 $202.18 20% $0.00 $161.75 001222 Passenger Bridgestone DRIVEGUARD 235/55RF18 $247.06 20% $0.00 $197.66 001223 Passenger Bridgestone DRIVEGUARD 225/65RF16 $199.73 20% $0.00 $159.79 001224 Passenger Bridgestone DRIVEGUARD 225/60RF17 $202.29 20% $0.00 $161.84 001372 Passenger Bridgestone DRIVEGUARD 215/55RF16 $159.51 20% $0.00 $127.61 001373 Passenger Bridgestone DRIVEGUARD 225/45RF17 $218.94 20% $0.00 $175.16 001374 Passenger Bridgestone DRIVEGUARD 225/50RF17 $220.18 20% $0.00 $176.15 001375 Passenger Bridgestone DRIVEGUARD 235/45RF17 $220.87 20% $0.00 $176.70 001376 Passenger Bridgestone DRIVEGUARD 245/45RF18 $268.26 20% $0.00 $214.62 003219 Passenger Bridgestone DRIVEGUARD 225/55RF18 $180.60 20% $0.00 $144.48 003224 Passenger Bridgestone DRIVEGUARD 235/55RF19 XL $255.94 20% $0.00 $204.76 003225 Passenger Bridgestone DRIVEGUARD 245/50RF20 $306.96 20% $0.00 $245.58 003230 Passenger Bridgestone DRIVEGUARD 195/60RF15 $135.40 20% $0.00 $108.33 003232 Passenger Bridgestone DRIVEGUARD 205/65RF16 $144.12 20% $0.00 $115.30 003233 Passenger Bridgestone DRIVEGUARD 225/55RF17 $206.80 20% $0.00 $165.45 003641 Passenger Bridgestone DRIVEGUARD 225/60RF18 $180.15 20% $0.00 $144.12 003642 Passenger Bridgestone DRIVEGUARD 235/55RF17 $204.23 20% $0.00 $163.39 011442 Passenger Bridgestone DRIVEGUARD 195/65RF15 $128.95 20% $0.00 $103.17 011459 Passenger Bridgestone DRIVEGUARD 215/55RF18 $204.23 20% $0.00 $163.39 011476 Passenger Bridgestone DRIVEGUARD 195/55RF16 $155.32 20% $0.00 $124.26 011510 Passenger Bridgestone DRIVEGUARD 205/55RF16 $163.29 20% $0.00 $130.64 011527 Passenger Bridgestone DRIVEGUARD 205/60RF16 $156.40 20% $0.00 $125.13 011561 Passenger Bridgestone DRIVEGUARD 215/60RF16 $172.48 20% $0.00 $137.99 011578 Passenger Bridgestone DRIVEGUARD 225/60RF16 $179.38 20% $0.00 $143.51 011612 Passenger Bridgestone DRIVEGUARD 205/45RF17 XL $200.09 20% $0.00 $160.08 011629 Passenger Bridgestone DRIVEGUARD 205/50RF17 XL $204.44 20% $0.00 $163.56 011646 Passenger Bridgestone DRIVEGUARD 215/45RF17 XL $202.18 20% $0.00 $161.75 011663 Passenger Bridgestone DRIVEGUARD 215/50RF17 XL $203.88 20% $0.00 $163.11 011680 Passenger Bridgestone DRIVEGUARD 215/55RF17 $203.01 20% $0.00 $162.41 011748 Passenger Bridgestone DRIVEGUARD 245/45RF17 XL $234.05 20% $0.00 $187.25 011765 Passenger Bridgestone DRIVEGUARD 255/40RF17 $253.04 20% $0.00 $202.44 011782 Passenger Bridgestone DRIVEGUARD 225/40RF18 XL $255.70 20% $0.00 $204.57 011799 Passenger Bridgestone DRIVEGUARD 225/45RF18 XL $236.03 20% $0.00 $188.83 011816 Passenger Bridgestone DRIVEGUARD 225/50RF18 $216.58 20% $0.00 $173.28 011833 Passenger Bridgestone DRIVEGUARD 235/40RF18 XL $268.48 20% $0.00 $214.79 011850 Passenger Bridgestone DRIVEGUARD 235/50RF18 $283.07 20% $0.00 $226.47 011867 Passenger Bridgestone DRIVEGUARD 245/40RF18 XL $281.92 20% $0.00 $225.55 011901 Passenger Bridgestone DRIVEGUARD 255/35RF18 XL $309.92 20% $0.00 $247.95 011918 Passenger Bridgestone DRIVEGUARD 245/40RF19 XL $337.41 20% $0.00 $269.94 017800 Passenger Bridgestone DRIVEGUARD 235/45RF18 XL $247.83 20% $0.00 $198.27 019687 Passenger Bridgestone DRIVEGUARD 215/45RF18 XL $231.15 20% $0.00 $184.93 019721 Passenger Bridgestone DRIVEGUARD 245/40RF17 $240.98 20% $0.00 $192.79 019738 Passenger Bridgestone DRIVEGUARD 255/45RF18 $281.67 20% $0.00 $225.35 019772 Passenger Bridgestone DRIVEGUARD 255/40RF18 XL $296.01 20% $0.00 $236.82 019789 Passenger Bridgestone DRIVEGUARD 235/50RF17 $225.73 20% $0.00 $180.59 004868 Passenger Bridgestone DUELER A/T 693 III 285/60R18 $292.55 20% $0.00 $234.04 081286 Passenger Bridgestone DUELER A/T REVO 2 P245/65R17 $260.19 NET $0.00 $116.51 081303 Passenger Bridgestone DUELER A/T REVO 2 P265/70R17 $257.04 NET $0.00 $129.31 081320 Passenger Bridgestone DUELER A/T REVO 2 P245/70R16 $222.14 NET $0.00 $118.36 081354 Passenger Bridgestone DUELER A/T REVO 2 P235/70R16 $212.91 NET $0.00 $110.96 081371 Passenger Bridgestone DUELER A/T REVO 2 P265/75R16 $224.33 NET $0.00 $130.41 081405 Passenger Bridgestone DUELER A/T REVO 2 P245/75R16 $207.55 NET $0.00 $120.08 081439 Passenger Bridgestone DUELER A/T REVO 2 P285/70R17 $272.70 NET $0.00 $144.82 081456 Passenger Bridgestone DUELER A/T REVO 2 P235/75R17 $228.57 NET $0.00 $113.33 081473 Passenger Bridgestone DUELER A/T REVO 2 P265/70R18 $278.97 NET $0.00 $136.00 081524 Passenger Bridgestone DUELER A/T REVO 2 P255/70R16 $229.73 NET $0.00 $121.74 081541 Passenger Bridgestone DUELER A/T REVO 2 P265/70R16 $242.92 NET $0.00 $127.60 081592 Passenger Bridgestone DUELER A/T REVO 2 P265/65R17 $281.48 NET $0.00 $126.05 081609 Passenger Bridgestone DUELER A/T REVO 2 P275/65R18 $307.02 NET $0.00 $138.09 081626 Passenger Bridgestone DUELER A/T REVO 2 P245/70R17 $235.04 NET $0.00 $116.55 081643 Passenger Bridgestone DUELER A/T REVO 2 P255/70R17 $243.09 NET $0.00 $122.30 081660 Passenger Bridgestone DUELER A/T REVO 2 P255/65R17 $279.51 NET $0.00 $125.17 081677 Passenger Bridgestone DUELER A/T REVO 2 P245/75R17 $238.64 NET $0.00 $124.87 081694 Passenger Bridgestone DUELER A/T REVO 2 P235/75R15 XL $196.93 NET $0.00 $109.77 102196 Passenger Bridgestone DUELER A/T REVO 2 P255/70R18 $267.80 NET $0.00 $129.49 102213 Passenger Bridgestone DUELER A/T REVO 2 P265/65R18 $294.76 NET $0.00 $132.01 Page 9 of 5688 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 102230 Passenger Bridgestone DUELER A/T REVO 2 P265/60R18 $301.34 NET $0.00 $134.95 102247 Passenger Bridgestone DUELER A/T REVO 2 P235/65R17 $252.36 NET $0.00 $109.21 102264 Passenger Bridgestone DUELER A/T REVO 2 P275/60R20 $322.43 NET $0.00 $144.54 102281 Passenger Bridgestone DUELER A/T REVO 2 P275/55R20 $332.74 NET $0.00 $149.02 123276 Passenger Bridgestone DUELER A/T REVO 2 P285/45R22 $397.06 NET $0.00 $151.58 000865 Passenger Bridgestone DUELER A/T RH-S 255/70R18 $251.45 20% $0.00 $201.17 002993 Passenger Bridgestone DUELER A/T RH-S P265/70R17 $221.65 20% $0.00 $177.33 003349 Passenger Bridgestone DUELER A/T RH-S 245/75R17 $194.06 20% $0.00 $155.25 054018 Passenger Bridgestone DUELER A/T RH-S P265/65R18 $256.54 20% $0.00 $205.24 054035 Passenger Bridgestone DUELER A/T RH-S P265/65R18 $269.35 20% $0.00 $215.48 057945 Passenger Bridgestone DUELER A/T RH-S P255/70R18 $251.45 20% $0.00 $201.17 086097 Passenger Bridgestone DUELER A/T RH-S P265/70R17 $232.75 20% $0.00 $186.21 107942 Passenger Bridgestone DUELER A/T RH-S P285/45R22 $350.02 20% $0.00 $280.02 003627 Passenger Bridgestone DUELER H/L 33 235/55R18 $253.61 20% $0.00 $202.89 003628 Passenger Bridgestone DUELER H/L 33 225/60R18 $222.03 20% $0.00 $177.63 000632 Passenger Bridgestone DUELER H/L 400 P225/55R18 $228.61 20% $0.00 $182.89 002687 Passenger Bridgestone DUELER H/L 400 275/45R20 XL $261.35 20% $0.00 $209.08 003197 Passenger Bridgestone DUELER H/L 400 255/55R18 $258.40 20% $0.00 $206.72 013958 Passenger Bridgestone DUELER H/L 400 265/50R19 XL $296.29 20% $0.00 $237.03 086131 Passenger Bridgestone DUELER H/L 400 P245/55R19 $273.35 20% $0.00 $218.68 087372 Passenger Bridgestone DUELER H/L 400 P235/60R18 $260.11 20% $0.00 $208.09 092982 Passenger Bridgestone DUELER H/L 400 255/55R18 XL $267.47 20% $0.00 $213.98 095260 Passenger Bridgestone DUELER H/L 400 P245/50R20 $299.74 20% $0.00 $239.80 112056 Passenger Bridgestone DUELER H/L 400 P245/65R17 $221.15 20% $0.00 $176.92 118312 Passenger Bridgestone DUELER H/L 400 P265/45R21 $344.74 20% $0.00 $275.80 126761 Passenger Bridgestone DUELER H/L 400 P235/60R18 $242.75 20% $0.00 $194.20 131300 Passenger Bridgestone DUELER H/L 400 255/55R17 $262.34 20% $0.00 $209.88 133272 Passenger Bridgestone DUELER H/L 400 P245/60R18 $252.89 20% $0.00 $202.31 133289 Passenger Bridgestone DUELER H/L 400 P235/55R19 $286.80 20% $0.00 $229.44 135618 Passenger Bridgestone DUELER H/L 400 P235/55R19 $263.85 20% $0.00 $211.08 142469 Passenger Bridgestone DUELER H/L 400 ECOPIA P215/70R17 $188.85 20% $0.00 $151.08 003774 Passenger Bridgestone DUELER H/L 400 EXT 235/50R18 $271.99 20% $0.00 $217.59 126319 Passenger Bridgestone DUELER H/L 400 MOE 275/50R20 $314.78 20% $0.00 $251.82 058234 Passenger Bridgestone DUELER H/L 400 RFT 255/55R18 XL $294.52 20% $0.00 $235.61 058268 Passenger Bridgestone DUELER H/L 400 RFT 255/50R19 XL $296.83 20% $0.00 $237.47 126404 Passenger Bridgestone DUELER H/L 400 RFT 245/55R17 $260.83 20% $0.00 $208.66 131249 Passenger Bridgestone DUELER H/L 400 RFT P235/55R18 $262.25 20% $0.00 $209.80 000010 Passenger Bridgestone DUELER H/L 422 ECOPIA P215/70R16 $189.31 20% $0.00 $151.45 001367 Passenger Bridgestone DUELER H/L 422 ECOPIA 235/50R18 $235.34 20% $0.00 $188.28 001368 Passenger Bridgestone DUELER H/L 422 ECOPIA 225/55R19 $255.54 20% $0.00 $204.44 001370 Passenger Bridgestone DUELER H/L 422 ECOPIA P255/50R20 $321.69 20% $0.00 $257.36 002908 Passenger Bridgestone DUELER H/L 422 ECOPIA 235/55R19 XL $265.23 20% $0.00 $212.19 006508 Passenger Bridgestone DUELER H/L 422 ECOPIA P245/60R18 $233.51 20% $0.00 $186.82 006509 Passenger Bridgestone DUELER H/L 422 ECOPIA 245/55R19 $256.68 20% $0.00 $205.35 122766 Passenger Bridgestone DUELER H/L 422 ECOPIA P235/70R16 $188.88 20% $0.00 $151.10 122817 Passenger Bridgestone DUELER H/L 422 ECOPIA 225/65R17 $193.36 20% $0.00 $154.69 122834 Passenger Bridgestone DUELER H/L 422 ECOPIA P235/55R18 $233.47 20% $0.00 $186.78 144373 Passenger Bridgestone DUELER H/L 422 ECOPIA P255/65R18 $231.55 20% $0.00 $185.24 144407 Passenger Bridgestone DUELER H/L 422 ECOPIA P245/65R17 $206.46 20% $0.00 $165.17 144424 Passenger Bridgestone DUELER H/L 422 ECOPIA P245/55R19 $256.68 20% $0.00 $205.35 144441 Passenger Bridgestone DUELER H/L 422 ECOPIA P245/60R18 $243.23 20% $0.00 $194.59 144458 Passenger Bridgestone DUELER H/L 422 ECOPIA P255/60R19 $248.15 20% $0.00 $198.52 144475 Passenger Bridgestone DUELER H/L 422 ECOPIA P245/50R20 $322.21 20% $0.00 $257.77 146022 Passenger Bridgestone DUELER H/L 422 ECOPIA 225/70R16 $194.32 20% $0.00 $155.46 146039 Passenger Bridgestone DUELER H/L 422 ECOPIA P235/65R18 $213.39 20% $0.00 $170.72 146090 Passenger Bridgestone DUELER H/L 422 ECOPIA 215/65R16 XL $221.77 20% $0.00 $177.42 146107 Passenger Bridgestone DUELER H/L 422 ECOPIA 235/60R18 XL $252.46 20% $0.00 $201.98 146124 Passenger Bridgestone DUELER H/L 422 ECOPIA 255/55R18 XL $260.06 20% $0.00 $208.06 146158 Passenger Bridgestone DUELER H/L 422 ECOPIA 235/65R17 XL $221.55 20% $0.00 $177.24 146175 Passenger Bridgestone DUELER H/L 422 ECOPIA 235/60R17 $211.16 20% $0.00 $168.93 047456 Passenger Bridgestone DUELER H/L 683 P265/65R18 $274.81 20% $0.00 $219.85 000862 Passenger Bridgestone DUELER H/L ALENZA 275/55R20 $251.12 20% $0.00 $200.90 000863 Passenger Bridgestone DUELER H/L ALENZA 275/55R20 $241.47 20% $0.00 $193.18 003012 Passenger Bridgestone DUELER H/L ALENZA P275/60R20 $278.07 20% $0.00 $222.46 003491 Passenger Bridgestone DUELER H/L ALENZA 255/65R18 $215.68 20% $0.00 $172.55 007156 Passenger Bridgestone DUELER H/L ALENZA P255/55R20 $262.69 20% $0.00 $210.16 023716 Passenger Bridgestone DUELER H/L ALENZA P285/45R22 $334.43 20% $0.00 $267.55 053967 Passenger Bridgestone DUELER H/L ALENZA P275/55R20 $241.47 20% $0.00 $193.18 058574 Passenger Bridgestone DUELER H/L ALENZA P275/55R20 $277.30 20% $0.00 $221.84 133986 Passenger Bridgestone DUELER H/L ALENZA 275/55R20 $277.30 20% $0.00 $221.84 000428 Passenger Bridgestone DUELER H/L ALENZA PLUS P235/75R15 $182.81 20% $0.00 $146.25 000430 Passenger Bridgestone DUELER H/L ALENZA PLUS P225/75R16 $187.73 20% $0.00 $150.19 000431 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/75R16 $201.53 20% $0.00 $161.23 000433 Passenger Bridgestone DUELER H/L ALENZA PLUS 235/70R16 $211.45 20% $0.00 $169.16 000434 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/70R16 $220.66 20% $0.00 $176.54 000435 Passenger Bridgestone DUELER H/L ALENZA PLUS P255/70R16 $217.49 20% $0.00 $174.00 000436 Passenger Bridgestone DUELER H/L ALENZA PLUS 265/70R16 $228.12 20% $0.00 $182.50 000437 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/65R16 $229.41 20% $0.00 $183.53 000438 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/70R17 $220.49 20% $0.00 $176.40 000439 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/70R17 $233.91 20% $0.00 $187.13 000441 Passenger Bridgestone DUELER H/L ALENZA PLUS 235/65R17 $217.02 20% $0.00 $173.62 000442 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/65R17 $239.55 20% $0.00 $191.64 000445 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/65R17 $260.75 20% $0.00 $208.60 000446 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/60R17 $227.31 20% $0.00 $181.85 000447 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/70R18 $258.50 20% $0.00 $206.80 000448 Passenger Bridgestone DUELER H/L ALENZA PLUS P255/65R18 $255.62 20% $0.00 $204.50 000449 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/65R18 $277.38 20% $0.00 $221.91 000451 Passenger Bridgestone DUELER H/L ALENZA PLUS P275/65R18 $286.94 20% $0.00 $229.56 000452 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/60R18 $238.77 20% $0.00 $191.02 000453 Passenger Bridgestone DUELER H/L ALENZA PLUS 265/60R18 $262.38 20% $0.00 $209.91 000454 Passenger Bridgestone DUELER H/L ALENZA PLUS 275/60R18 $273.56 20% $0.00 $218.85 000455 Passenger Bridgestone DUELER H/L ALENZA PLUS 235/55R18 $248.93 20% $0.00 $199.15 000456 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/55R19 $264.76 20% $0.00 $211.81 000457 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/55R19 XL $299.25 20% $0.00 $239.40 000458 Passenger Bridgestone DUELER H/L ALENZA PLUS P235/50R19 $266.01 20% $0.00 $212.81 000459 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/50R19 XL $314.21 20% $0.00 $251.37 000462 Passenger Bridgestone DUELER H/L ALENZA PLUS P275/60R20 $278.07 20% $0.00 $222.46 000463 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/50R20 XL $315.47 20% $0.00 $252.38 000464 Passenger Bridgestone DUELER H/L ALENZA PLUS P285/50R20 $353.21 20% $0.00 $282.58 000465 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/50R20 $317.49 20% $0.00 $254.00 001331 Passenger Bridgestone DUELER H/L ALENZA PLUS P245/60R20 $255.85 20% $0.00 $204.68 001332 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/75R16 $228.75 20% $0.00 $183.01 001464 Passenger Bridgestone DUELER H/L ALENZA PLUS P265/70R15 $225.30 20% $0.00 $180.24 Page 10 of 5689 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 001732 Passenger Bridgestone DUELER H/L ALENZA PLUS P255/55R20 $275.82 20% $0.00 $220.66 001733 Passenger Bridgestone DUELER H/L ALENZA PLUS P275/55R20 $277.30 20% $0.00 $221.84 001734 Passenger Bridgestone DUELER H/L ALENZA PLUS P285/45R22 $366.28 20% $0.00 $293.03 003859 Passenger Bridgestone DUELER H/L ALENZA PLUS 255/55R18 XL $287.85 20% $0.00 $230.29 004083 Passenger Bridgestone DUELER H/L ALENZA PLUS P235/50R19 $266.01 20% $0.00 $212.81 005402 Passenger Bridgestone DUELER H/L ALENZA PLUS 275/45R21 XL $314.18 20% $0.00 $251.35 126812 Passenger Bridgestone DUELER H/P 92A P265/50R20 $325.30 20% $0.00 $260.24 127356 Passenger Bridgestone DUELER H/P 92A P265/60R18 $299.56 20% $0.00 $239.65 000867 Passenger Bridgestone DUELER H/P SPORT 265/60R18 $258.28 20% $0.00 $206.63 003234 Passenger Bridgestone DUELER H/P SPORT 235/55R17 $228.92 20% $0.00 $183.13 003235 Passenger Bridgestone DUELER H/P SPORT 235/50R18 $254.05 20% $0.00 $203.24 003837 Passenger Bridgestone DUELER H/P SPORT 285/60R18 $348.93 20% $0.00 $279.15 004856 Passenger Bridgestone DUELER H/P SPORT 235/55R19 $285.68 20% $0.00 $228.55 006942 Passenger Bridgestone DUELER H/P SPORT 235/45R19 $302.36 20% $0.00 $241.89 007213 Passenger Bridgestone DUELER H/P SPORT 225/60R18 $220.12 20% $0.00 $176.09 049020 Passenger Bridgestone DUELER H/P SPORT 255/50R19 $290.16 20% $0.00 $232.13 067890 Passenger Bridgestone DUELER H/P SPORT 255/55R18 XL $275.60 20% $0.00 $220.48 067924 Passenger Bridgestone DUELER H/P SPORT 285/45R19 $332.46 20% $0.00 $265.97 089038 Passenger Bridgestone DUELER H/P SPORT 275/45R20 XL $337.76 20% $0.00 $270.21 095107 Passenger Bridgestone DUELER H/P SPORT 275/40R20 $334.22 20% $0.00 $267.38 095124 Passenger Bridgestone DUELER H/P SPORT 315/35R20 $404.98 20% $0.00 $323.99 098864 Passenger Bridgestone DUELER H/P SPORT 275/45R19 XL $328.61 20% $0.00 $262.89 131317 Passenger Bridgestone DUELER H/P SPORT 235/50R19 $267.42 20% $0.00 $213.94 133306 Passenger Bridgestone DUELER H/P SPORT 255/45R20 $311.27 20% $0.00 $249.02 133595 Passenger Bridgestone DUELER H/P SPORT 235/45R20 XL $299.43 20% $0.00 $239.54 141568 Passenger Bridgestone DUELER H/P SPORT 235/55R19 $289.22 20% $0.00 $231.38 000200 Passenger Bridgestone DUELER H/P SPORT AS 245/60R18 $238.80 20% $0.00 $191.04 000234 Passenger Bridgestone DUELER H/P SPORT AS 225/65R17 $194.73 20% $0.00 $155.78 000235 Passenger Bridgestone DUELER H/P SPORT AS 225/60R18 $220.07 20% $0.00 $176.06 000324 Passenger Bridgestone DUELER H/P SPORT AS 275/40R20 XL $294.67 20% $0.00 $235.73 000749 Passenger Bridgestone DUELER H/P SPORT AS 235/55R20 $277.03 20% $0.00 $221.63 001461 Passenger Bridgestone DUELER H/P SPORT AS 245/60R18 $248.35 20% $0.00 $198.68 004440 Passenger Bridgestone DUELER H/P SPORT AS 235/55R20 $277.03 20% $0.00 $221.63 004747 Passenger Bridgestone DUELER H/P SPORT AS 245/50R19 XL $229.49 20% $0.00 $183.59 142367 Passenger Bridgestone DUELER H/P SPORT AS 225/65R17 $189.76 20% $0.00 $151.81 145869 Passenger Bridgestone DUELER H/P SPORT AS P255/60R19 $238.24 20% $0.00 $190.59 145903 Passenger Bridgestone DUELER H/P SPORT AS 235/65R17 XL $209.10 20% $0.00 $167.28 145937 Passenger Bridgestone DUELER H/P SPORT AS 235/60R18 XL $237.13 20% $0.00 $189.71 145954 Passenger Bridgestone DUELER H/P SPORT AS 255/55R18 XL $249.68 20% $0.00 $199.74 004743 Passenger Bridgestone DUELER H/P SPORT AS RFT 225/60R18 XL $226.68 20% $0.00 $181.34 004748 Passenger Bridgestone DUELER H/P SPORT AS RFT 245/50R19 XL $226.68 20% $0.00 $181.34 006651 Passenger Bridgestone DUELER H/P SPORT AS RFT 235/60R18 $260.85 20% $0.00 $208.68 005220 Passenger Bridgestone DUELER H/P SPORT ECOPIA 205/60R16 $205.93 20% $0.00 $164.75 003776 Passenger Bridgestone DUELER H/P SPORT EXT 235/45R19 $290.24 20% $0.00 $232.19 005180 Passenger Bridgestone DUELER H/P SPORT MOE 255/45R20 $303.81 20% $0.00 $243.05 135686 Passenger Bridgestone DUELER H/P SPORT MOE 265/45R20 $312.58 20% $0.00 $250.07 007957 Passenger Bridgestone DUELER H/P SPORT RFT 205/55R17 $264.81 20% $0.00 $211.85 007974 Passenger Bridgestone DUELER H/P SPORT RFT 225/45R18 $364.35 20% $0.00 $291.48 058285 Passenger Bridgestone DUELER H/P SPORT RFT 255/50R19 XL $327.78 20% $0.00 $262.22 058302 Passenger Bridgestone DUELER H/P SPORT RFT 285/45R19 XL $358.21 20% $0.00 $286.57 090075 Passenger Bridgestone DUELER H/P SPORT RFT 255/50R19 XL $312.17 20% $0.00 $249.74 090092 Passenger Bridgestone DUELER H/P SPORT RFT 285/45R19 XL $341.15 20% $0.00 $272.92 112243 Passenger Bridgestone DUELER H/P SPORT RFT 275/40R20 XL $359.58 20% $0.00 $287.67 112260 Passenger Bridgestone DUELER H/P SPORT RFT 315/35R20 XL $466.56 20% $0.00 $373.25 112991 Passenger Bridgestone DUELER H/P SPORT RFT 275/40R20 XL $359.58 20% $0.00 $287.67 113008 Passenger Bridgestone DUELER H/P SPORT RFT 315/35R20 XL $466.56 20% $0.00 $373.25 002959 Passenger Bridgestone DUELER H/T 684 II P255/70R17 $200.90 20% $0.00 $160.72 004639 Passenger Bridgestone DUELER H/T 684 II P255/70R17 $200.90 20% $0.00 $160.72 004945 Passenger Bridgestone DUELER H/T 684 II P255/70R18 $212.59 20% $0.00 $170.07 030456 Passenger Bridgestone DUELER H/T 684 II P265/65R17 $204.29 20% $0.00 $163.44 043614 Passenger Bridgestone DUELER H/T 684 II P265/65R18 $222.23 20% $0.00 $177.79 055089 Passenger Bridgestone DUELER H/T 684 II P275/65R18 $243.70 20% $0.00 $194.97 058438 Passenger Bridgestone DUELER H/T 684 II P235/60R18 $214.39 20% $0.00 $171.52 112889 Passenger Bridgestone DUELER H/T 684 II P285/60R18 $267.89 20% $0.00 $214.32 116816 Passenger Bridgestone DUELER H/T 684 II P265/70R17 $209.60 20% $0.00 $167.68 126591 Passenger Bridgestone DUELER H/T 684 II P275/65R18 $243.70 20% $0.00 $194.97 142741 Passenger Bridgestone DUELER H/T 684 II P245/70R17 $193.16 20% $0.00 $154.53 142758 Passenger Bridgestone DUELER H/T 684 II P245/60R20 $246.41 20% $0.00 $197.13 149779 Passenger Bridgestone DUELER H/T 684 II P275/60R20 $258.85 20% $0.00 $207.08 149796 Passenger Bridgestone DUELER H/T 684 II P275/50R22 $317.03 20% $0.00 $253.63 003348 Passenger Bridgestone DUELER H/T 685 245/75R17 $230.26 20% $0.00 $184.21 003492 Passenger Bridgestone DUELER H/T 685 255/70R18 $223.43 20% $0.00 $178.74 003794 Passenger Bridgestone DUELER H/T 685 275/65R18 $263.51 20% $0.00 $210.81 001785 Passenger Bridgestone DUELER H/T 687 235/55R18 $229.76 20% $0.00 $183.82 072633 Passenger Bridgestone DUELER H/T 687 225/65R17 $192.94 20% $0.00 $154.36 120165 Passenger Bridgestone DUELER H/T 687 P235/65R18 $199.98 20% $0.00 $159.98 032020 Passenger Bridgestone DUELER H/T 689 265/70R16 $192.60 20% $0.00 $154.09 076554 Passenger Bridgestone DUELER H/T 689 P255/65R16 $201.41 20% $0.00 $161.13 092061 Passenger Bridgestone DUELER H/T 689 P265/70R16 $192.60 20% $0.00 $154.09 092827 Passenger Bridgestone DUELER H/T 689 P245/65R17 $187.89 20% $0.00 $150.31 000893 Passenger Bridgestone DUELER H/T 840 P265/65R17 $201.78 20% $0.00 $161.43 006389 Passenger Bridgestone DUELER H/T 840 245/75R16 $168.53 20% $0.00 $134.83 006390 Passenger Bridgestone DUELER H/T 840 255/70R18 $209.99 20% $0.00 $167.99 072599 Passenger Bridgestone DUELER H/T 840 P265/60R18 $237.31 20% $0.00 $189.85 089089 Passenger Bridgestone DUELER H/T 840 245/75R16 $168.53 20% $0.00 $134.83 089106 Passenger Bridgestone DUELER H/T 840 255/70R18 $209.99 20% $0.00 $167.99 133323 Passenger Bridgestone ECOPIA EP03 215/70R16 $190.71 20% $0.00 $152.57 000965 Passenger Bridgestone ECOPIA EP150 185/55R15 $119.26 20% $0.00 $95.41 001483 Passenger Bridgestone ECOPIA EP150 175/65R15 $103.32 20% $0.00 $82.66 002096 Passenger Bridgestone ECOPIA EP150 205/55R16 $146.47 20% $0.00 $117.18 005917 Passenger Bridgestone ECOPIA EP20 P195/65R15 $121.16 20% $0.00 $96.93 133459 Passenger Bridgestone ECOPIA EP20 P195/65R15 $121.16 20% $0.00 $96.93 000214 Passenger Bridgestone ECOPIA EP422 215/55R17 $190.75 NET $0.00 $97.77 000215 Passenger Bridgestone ECOPIA EP422 235/45R18 $222.26 NET $0.00 $122.70 004285 Passenger Bridgestone ECOPIA EP422 P205/55R16 $141.86 NET $0.00 $84.03 024583 Passenger Bridgestone ECOPIA EP422 P185/60R15 $112.59 NET $0.00 $67.12 Discontinued w 024957 Passenger Bridgestone ECOPIA EP422 P185/65R15 $117.18 NET $0.00 $56.40 024974 Passenger Bridgestone ECOPIA EP422 P195/55R16 $145.52 NET $0.00 $67.11 000219 Passenger Bridgestone ECOPIA EP422 PLUS 215/55R17 $199.25 20% $0.00 $159.41 001448 Passenger Bridgestone ECOPIA EP422 PLUS 235/60R16 $156.51 20% $0.00 $125.21 001667 Passenger Bridgestone ECOPIA EP422 PLUS 195/65R15 $122.68 NET $0.00 $65.01 001863 Passenger Bridgestone ECOPIA EP422 PLUS P205/60R16 $138.92 NET $0.00 $76.96 002005 Passenger Bridgestone ECOPIA EP422 PLUS 205/70R15 $104.29 20% $0.00 $83.43 Page 11 of 5690 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 002008 Passenger Bridgestone ECOPIA EP422 PLUS 205/60R15 $120.36 20% $0.00 $96.30 002009 Passenger Bridgestone ECOPIA EP422 PLUS 215/60R15 $120.16 20% $0.00 $96.14 003193 Passenger Bridgestone ECOPIA EP422 PLUS 205/55R16 $142.26 NET $0.00 $73.78 003767 Passenger Bridgestone ECOPIA EP422 PLUS 235/45R18 $257.28 20% $0.00 $205.83 004328 Passenger Bridgestone ECOPIA EP422 PLUS 185/55R16 $134.49 20% $0.00 $107.59 004866 Passenger Bridgestone ECOPIA EP422 PLUS P225/45R17 $205.40 20% $0.00 $164.33 005332 Passenger Bridgestone ECOPIA EP422 PLUS P195/65R15 $117.75 20% $0.00 $94.20 005333 Passenger Bridgestone ECOPIA EP422 PLUS P215/45R17 $197.49 20% $0.00 $158.00 005968 Passenger Bridgestone ECOPIA EP422 PLUS 225/60R16 $150.48 NET $0.00 $83.37 005985 Passenger Bridgestone ECOPIA EP422 PLUS 215/60R16 $138.92 NET $0.00 $82.86 006002 Passenger Bridgestone ECOPIA EP422 PLUS 215/60R16 $154.01 20% $0.00 $123.21 006019 Passenger Bridgestone ECOPIA EP422 PLUS 205/65R15 XL $132.06 20% $0.00 $105.65 006036 Passenger Bridgestone ECOPIA EP422 PLUS 195/65R15 $122.68 NET $0.00 $65.01 006053 Passenger Bridgestone ECOPIA EP422 PLUS 215/70R15 $121.32 20% $0.00 $97.06 006070 Passenger Bridgestone ECOPIA EP422 PLUS 205/55R16 $142.26 NET $0.00 $83.35 006087 Passenger Bridgestone ECOPIA EP422 PLUS 215/65R16 $138.95 NET $0.00 $82.92 006104 Passenger Bridgestone ECOPIA EP422 PLUS 195/60R15 $115.73 NET $0.00 $70.36 006121 Passenger Bridgestone ECOPIA EP422 PLUS 205/60R16 $138.92 NET $0.00 $73.29 006138 Passenger Bridgestone ECOPIA EP422 PLUS 185/65R15 $117.51 NET $0.00 $60.23 006155 Passenger Bridgestone ECOPIA EP422 PLUS 235/65R16 $152.22 NET $0.00 $96.11 006172 Passenger Bridgestone ECOPIA EP422 PLUS 225/60R17 $172.96 20% $0.00 $138.37 006189 Passenger Bridgestone ECOPIA EP422 PLUS 215/55R17 $199.25 20% $0.00 $159.41 006206 Passenger Bridgestone ECOPIA EP422 PLUS 225/55R17 $205.90 NET $0.00 $101.60 006223 Passenger Bridgestone ECOPIA EP422 PLUS 225/50R17 $213.88 NET $0.00 $110.34 006240 Passenger Bridgestone ECOPIA EP422 PLUS 225/65R17 $158.16 NET $0.00 $82.44 006257 Passenger Bridgestone ECOPIA EP422 PLUS 215/60R17 $154.22 NET $0.00 $79.05 006274 Passenger Bridgestone ECOPIA EP422 PLUS 215/55R16 $147.95 NET $0.00 $77.74 006291 Passenger Bridgestone ECOPIA EP422 PLUS 185/60R15 $112.92 20% $0.00 $90.34 006308 Passenger Bridgestone ECOPIA EP422 PLUS 215/65R17 $150.64 20% $0.00 $120.51 006325 Passenger Bridgestone ECOPIA EP422 PLUS 215/50R17 XL $201.06 NET $0.00 $88.51 006342 Passenger Bridgestone ECOPIA EP422 PLUS 235/55R17 $210.02 20% $0.00 $168.02 006359 Passenger Bridgestone ECOPIA EP422 PLUS 235/55R18 $235.70 20% $0.00 $188.57 006393 Passenger Bridgestone ECOPIA EP422 PLUS 225/65R16 $150.28 20% $0.00 $120.23 006410 Passenger Bridgestone ECOPIA EP422 PLUS 225/60R18 $183.18 NET $0.00 $93.88 006427 Passenger Bridgestone ECOPIA EP422 PLUS 235/45R17 $213.61 20% $0.00 $170.89 006444 Passenger Bridgestone ECOPIA EP422 PLUS 235/60R17 $189.02 20% $0.00 $151.23 006478 Passenger Bridgestone ECOPIA EP422 PLUS 225/55R18 $248.29 20% $0.00 $198.64 006495 Passenger Bridgestone ECOPIA EP422 PLUS 205/50R17 XL $203.00 20% $0.00 $162.41 006512 Passenger Bridgestone ECOPIA EP422 PLUS 205/50R16 $148.69 20% $0.00 $118.96 006529 Passenger Bridgestone ECOPIA EP422 PLUS 225/50R18 $210.46 20% $0.00 $168.37 006546 Passenger Bridgestone ECOPIA EP422 PLUS 215/55R18 $229.19 20% $0.00 $183.36 006563 Passenger Bridgestone ECOPIA EP422 PLUS 195/55R16 $145.93 20% $0.00 $116.75 006597 Passenger Bridgestone ECOPIA EP422 PLUS 215/45R17 $197.49 20% $0.00 $158.00 006614 Passenger Bridgestone ECOPIA EP422 PLUS 175/65R15 $112.80 20% $0.00 $90.25 006631 Passenger Bridgestone ECOPIA EP422 PLUS 185/55R15 $133.08 20% $0.00 $106.47 006648 Passenger Bridgestone ECOPIA EP422 PLUS 225/45R18 $247.38 20% $0.00 $197.91 007223 Passenger Bridgestone ECOPIA EP422 PLUS 205/60R16 $138.92 20% $0.00 $111.14 007224 Passenger Bridgestone ECOPIA EP422 PLUS 225/45R18 $237.49 20% $0.00 $190.00 007237 Passenger Bridgestone ECOPIA EP422 PLUS 205/55R17 $185.14 20% $0.00 $148.12 008834 Passenger Bridgestone ECOPIA EP422 PLUS 205/60R16 $138.92 20% $0.00 $111.14 008835 Passenger Bridgestone ECOPIA EP422 PLUS 205/50R17 XL $194.89 20% $0.00 $155.92 009110 Passenger Bridgestone ECOPIA EP422 PLUS 215/55R17 $199.25 20% $0.00 $159.41 023206 Passenger Bridgestone ECOPIA EP422 PLUS 205/65R16 $144.06 20% $0.00 $115.26 001619 Passenger Bridgestone ECOPIA EP500 155/70R19 $143.02 20% $0.00 $114.42 001628 Passenger Bridgestone ECOPIA EP500 155/60R20 $161.23 20% $0.00 $128.98 001629 Passenger Bridgestone ECOPIA EP500 175/55R20 $175.97 20% $0.00 $140.78 001630 Passenger Bridgestone ECOPIA EP500 175/60R19 $156.02 20% $0.00 $124.82 004843 Passenger Bridgestone ECOPIA EP500 175/55R20 XL $175.97 20% $0.00 $140.78 001475 Passenger Bridgestone ECOPIA EP600 155/70R19 $155.15 20% $0.00 $124.12 001476 Passenger Bridgestone ECOPIA EP600 175/60R19 $169.90 20% $0.00 $135.92 000227 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/55R20 $264.36 20% $0.00 $211.49 000864 Passenger Bridgestone ECOPIA H/L 422 PLUS 265/50R20 $287.75 20% $0.00 $230.21 000888 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/65R17 $199.17 20% $0.00 $159.34 000889 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/60R18 $210.89 20% $0.00 $168.72 000985 Passenger Bridgestone ECOPIA H/L 422 PLUS 225/65R17 $191.50 20% $0.00 $153.20 001208 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/55R18 $221.98 20% $0.00 $177.59 003259 Passenger Bridgestone ECOPIA H/L 422 PLUS 225/65R17 $191.50 20% $0.00 $153.20 004492 Passenger Bridgestone ECOPIA H/L 422 PLUS 225/55R19 $223.77 20% $0.00 $179.02 004620 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/65R18 $217.48 20% $0.00 $173.99 005591 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/55R18 $221.98 20% $0.00 $177.59 007235 Passenger Bridgestone ECOPIA H/L 422 PLUS 235/55R18 $215.52 20% $0.00 $172.42 007236 Passenger Bridgestone ECOPIA H/L 422 PLUS 215/65R17 $194.35 20% $0.00 $155.49 008633 Passenger Bridgestone ECOPIA H/L 422 PLUS 225/45R19 $266.84 20% $0.00 $213.47 008789 Passenger Bridgestone ECOPIA H/L 422 PLUS P255/50R20 $298.78 20% $0.00 $239.03 021489 Passenger Bridgestone ECOPIA H/L 422 PLUS RFT P225/65RF17 $223.69 20% $0.00 $178.95 037540 Passenger Bridgestone EXPEDIA S-01 265/40ZR18 $407.66 20% $0.00 $326.13 085073 Passenger Bridgestone EXPEDIA S-01 255/45ZR17 $316.57 20% $0.00 $253.25 085081 Passenger Bridgestone EXPEDIA S-01 285/40ZR17 $364.13 20% $0.00 $291.31 001400 Passenger Firestone FIREHAWK AS 195/65R15 $78.07 20% $0.00 $62.46 001401 Passenger Firestone FIREHAWK AS 195/60R15 $82.18 20% $0.00 $65.74 001402 Passenger Firestone FIREHAWK AS 185/55R15 $86.64 20% $0.00 $69.31 001404 Passenger Firestone FIREHAWK AS 205/60R16 $98.80 20% $0.00 $79.04 001405 Passenger Firestone FIREHAWK AS 215/60R16 $106.87 20% $0.00 $85.50 001407 Passenger Firestone FIREHAWK AS 195/55R16 $95.00 20% $0.00 $76.00 001408 Passenger Firestone FIREHAWK AS 205/55R16 $108.34 20% $0.00 $86.67 001409 Passenger Firestone FIREHAWK AS 215/55R16 XL $116.61 20% $0.00 $93.29 001410 Passenger Firestone FIREHAWK AS 195/50R16 $99.75 20% $0.00 $79.80 001411 Passenger Firestone FIREHAWK AS 215/55R17 $124.97 20% $0.00 $99.98 001413 Passenger Firestone FIREHAWK AS 225/55R17 $130.18 20% $0.00 $104.14 001414 Passenger Firestone FIREHAWK AS 235/55R17 $139.58 20% $0.00 $111.67 001415 Passenger Firestone FIREHAWK AS 205/50R17 XL $125.98 20% $0.00 $100.78 001416 Passenger Firestone FIREHAWK AS 215/50R17 XL $131.02 20% $0.00 $104.81 001417 Passenger Firestone FIREHAWK AS 225/50R17 XL $132.78 20% $0.00 $106.23 001418 Passenger Firestone FIREHAWK AS 215/45R17 XL $118.05 20% $0.00 $94.44 001419 Passenger Firestone FIREHAWK AS 225/45R17 XL $124.19 20% $0.00 $99.35 001421 Passenger Firestone FIREHAWK AS 235/45R17 XL $134.73 20% $0.00 $107.78 001423 Passenger Firestone FIREHAWK AS 215/55R18 $124.77 20% $0.00 $99.82 001424 Passenger Firestone FIREHAWK AS 235/55R18 $138.39 20% $0.00 $110.72 001426 Passenger Firestone FIREHAWK AS 225/50R18 $148.28 20% $0.00 $118.63 001427 Passenger Firestone FIREHAWK AS 235/50R18 $162.39 20% $0.00 $129.91 001428 Passenger Firestone FIREHAWK AS 225/45R18 XL $156.08 20% $0.00 $124.86 001430 Passenger Firestone FIREHAWK AS 245/45R18 XL $183.71 20% $0.00 $146.97 001432 Passenger Firestone FIREHAWK AS 245/40R18 XL $187.33 20% $0.00 $149.86 Page 12 of 5691 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 001433 Passenger Firestone FIREHAWK AS 245/50R19 XL $189.81 20% $0.00 $151.85 001434 Passenger Firestone FIREHAWK AS 245/45R19 $186.14 20% $0.00 $148.91 001435 Passenger Firestone FIREHAWK AS 245/40R19 XL $195.46 20% $0.00 $156.36 001436 Passenger Firestone FIREHAWK AS 245/45R20 XL $178.46 20% $0.00 $142.77 001438 Passenger Firestone FIREHAWK AS 275/40R20 XL $218.97 20% $0.00 $175.17 004347 Passenger Firestone FIREHAWK AS 235/45R18 $141.46 20% $0.00 $113.17 004348 Passenger Firestone FIREHAWK AS 225/55R16 $105.68 20% $0.00 $84.55 004349 Passenger Firestone FIREHAWK AS 235/40R19 XL $187.24 20% $0.00 $149.79 006108 Passenger Firestone FIREHAWK AS 225/60R16 $104.84 20% $0.00 $83.88 006109 Passenger Firestone FIREHAWK AS 205/65R15 $79.66 20% $0.00 $63.73 006110 Passenger Firestone FIREHAWK AS 225/60R17 $116.67 20% $0.00 $93.34 006111 Passenger Firestone FIREHAWK AS 205/50R16 $118.31 20% $0.00 $94.65 006113 Passenger Firestone FIREHAWK AS 225/60R18 $122.51 20% $0.00 $98.01 006114 Passenger Firestone FIREHAWK AS 215/65R16 $91.95 20% $0.00 $73.56 006118 Passenger Firestone FIREHAWK AS 215/65R17 $102.15 20% $0.00 $81.72 006119 Passenger Firestone FIREHAWK AS 215/60R17 $107.53 20% $0.00 $86.02 006122 Passenger Firestone FIREHAWK AS 215/60R15 $97.47 20% $0.00 $77.97 006124 Passenger Firestone FIREHAWK AS 225/40R18 XL $155.99 20% $0.00 $124.79 006125 Passenger Firestone FIREHAWK AS 245/45R17 XL $149.02 20% $0.00 $119.21 006126 Passenger Firestone FIREHAWK AS 225/50R16 $115.59 20% $0.00 $92.48 006128 Passenger Firestone FIREHAWK AS 235/50R17 $138.27 NET $0.00 $92.14 006130 Passenger Firestone FIREHAWK AS 235/40R18 XL $158.36 20% $0.00 $126.69 006131 Passenger Firestone FIREHAWK AS 195/55R15 $90.25 20% $0.00 $72.20 000986 Passenger Firestone FIREHAWK GT H 225/45R17 $227.48 20% $0.00 $181.98 001548 Passenger Firestone FIREHAWK GT H 185/55R15 $110.23 20% $0.00 $88.18 004651 Passenger Firestone FIREHAWK GT H P235/50R18 $237.55 20% $0.00 $190.04 126965 Passenger Firestone FIREHAWK GT V 185/55R15 $119.81 20% $0.00 $95.85 134054 Passenger Firestone FIREHAWK GT V 245/45R20 $263.57 20% $0.00 $210.86 043495 Passenger Firestone FIREHAWK GTA-03 P215/55R18 $191.14 20% $0.00 $152.91 002921 Passenger Firestone FIREHAWK INDY 500 305/35R20 $280.96 20% $0.00 $224.77 002922 Passenger Firestone FIREHAWK INDY 500 285/35R20 $259.78 20% $0.00 $207.82 002924 Passenger Firestone FIREHAWK INDY 500 325/30R19 $303.90 20% $0.00 $243.12 002925 Passenger Firestone FIREHAWK INDY 500 265/40R19 $211.40 20% $0.00 $169.12 002926 Passenger Firestone FIREHAWK INDY 500 P245/50R19 XL $189.81 20% $0.00 $151.85 002927 Passenger Firestone FIREHAWK INDY 500 275/40R18 $167.88 20% $0.00 $134.30 002928 Passenger Firestone FIREHAWK INDY 500 235/50R18 XL $162.39 20% $0.00 $129.91 002929 Passenger Firestone FIREHAWK INDY 500 235/50R17 $146.55 20% $0.00 $117.24 002930 Passenger Firestone FIREHAWK INDY 500 235/55R17 $139.58 20% $0.00 $111.67 002931 Passenger Firestone FIREHAWK INDY 500 225/55R17 $130.18 20% $0.00 $104.14 002932 Passenger Firestone FIREHAWK INDY 500 195/55R16 $95.00 20% $0.00 $76.00 003260 Passenger Firestone FIREHAWK INDY 500 285/35R19 $247.41 20% $0.00 $197.93 004350 Passenger Firestone FIREHAWK INDY 500 235/55R18 $138.39 20% $0.00 $110.72 004351 Passenger Firestone FIREHAWK INDY 500 295/30R20 XL $283.67 20% $0.00 $226.93 004352 Passenger Firestone FIREHAWK INDY 500 215/55R17 $124.97 20% $0.00 $99.98 004354 Passenger Firestone FIREHAWK INDY 500 275/40R17 $159.89 20% $0.00 $127.91 011952 Passenger Firestone FIREHAWK INDY 500 255/45R18 XL $191.05 20% $0.00 $152.84 011969 Passenger Firestone FIREHAWK INDY 500 205/55R16 $108.34 20% $0.00 $86.67 011986 Passenger Firestone FIREHAWK INDY 500 205/50R16 $111.08 20% $0.00 $88.86 012003 Passenger Firestone FIREHAWK INDY 500 225/50R16 $120.53 20% $0.00 $96.42 012020 Passenger Firestone FIREHAWK INDY 500 205/45R16 XL $104.86 20% $0.00 $83.88 012037 Passenger Firestone FIREHAWK INDY 500 205/50R17 XL $125.98 20% $0.00 $100.78 012054 Passenger Firestone FIREHAWK INDY 500 225/50R17 $132.78 20% $0.00 $106.23 012071 Passenger Firestone FIREHAWK INDY 500 205/45R17 XL $132.29 20% $0.00 $105.84 012088 Passenger Firestone FIREHAWK INDY 500 215/45R17 XL $118.05 20% $0.00 $94.44 012105 Passenger Firestone FIREHAWK INDY 500 225/45R17 XL $124.19 20% $0.00 $99.35 012139 Passenger Firestone FIREHAWK INDY 500 235/45R17 $134.73 20% $0.00 $107.78 012156 Passenger Firestone FIREHAWK INDY 500 245/45R17 XL $135.38 20% $0.00 $108.31 012190 Passenger Firestone FIREHAWK INDY 500 205/40R17 XL $102.75 20% $0.00 $82.20 012207 Passenger Firestone FIREHAWK INDY 500 245/40R17 $141.72 20% $0.00 $113.38 012224 Passenger Firestone FIREHAWK INDY 500 255/40R17 $147.38 20% $0.00 $117.90 012241 Passenger Firestone FIREHAWK INDY 500 225/50R18 $148.28 20% $0.00 $118.63 012258 Passenger Firestone FIREHAWK INDY 500 215/45R18 XL $123.96 20% $0.00 $99.16 012275 Passenger Firestone FIREHAWK INDY 500 225/45R18 XL $156.08 20% $0.00 $124.86 012292 Passenger Firestone FIREHAWK INDY 500 235/45R18 XL $176.37 20% $0.00 $141.09 012309 Passenger Firestone FIREHAWK INDY 500 245/45R18 XL $183.71 20% $0.00 $146.97 012326 Passenger Firestone FIREHAWK INDY 500 215/40R18 XL $130.13 20% $0.00 $104.11 012360 Passenger Firestone FIREHAWK INDY 500 225/40R18 XL $128.20 20% $0.00 $102.56 012377 Passenger Firestone FIREHAWK INDY 500 235/40R18 XL $161.41 20% $0.00 $129.13 012394 Passenger Firestone FIREHAWK INDY 500 245/40R18 XL $187.33 20% $0.00 $149.86 012411 Passenger Firestone FIREHAWK INDY 500 255/40R18 XL $194.83 20% $0.00 $155.87 012428 Passenger Firestone FIREHAWK INDY 500 245/35R18 XL $202.54 20% $0.00 $162.03 012445 Passenger Firestone FIREHAWK INDY 500 255/35R18 XL $144.89 20% $0.00 $115.91 012462 Passenger Firestone FIREHAWK INDY 500 265/35R18 XL $212.27 20% $0.00 $169.82 012496 Passenger Firestone FIREHAWK INDY 500 275/35R18 $221.11 20% $0.00 $176.89 012530 Passenger Firestone FIREHAWK INDY 500 225/45R19 XL $163.89 20% $0.00 $131.11 012547 Passenger Firestone FIREHAWK INDY 500 245/45R19 $186.14 20% $0.00 $148.91 012581 Passenger Firestone FIREHAWK INDY 500 225/40R19 XL $134.60 20% $0.00 $107.68 012598 Passenger Firestone FIREHAWK INDY 500 245/40R19 XL $195.46 20% $0.00 $156.36 012615 Passenger Firestone FIREHAWK INDY 500 255/40R19 XL $203.27 20% $0.00 $162.62 012632 Passenger Firestone FIREHAWK INDY 500 275/40R19 $208.03 20% $0.00 $166.42 012649 Passenger Firestone FIREHAWK INDY 500 225/35R19 XL $180.68 20% $0.00 $144.54 012666 Passenger Firestone FIREHAWK INDY 500 235/35R19 XL $197.03 20% $0.00 $157.62 012683 Passenger Firestone FIREHAWK INDY 500 245/35R19 XL $205.23 20% $0.00 $164.19 012700 Passenger Firestone FIREHAWK INDY 500 255/35R19 XL $152.51 20% $0.00 $122.01 012717 Passenger Firestone FIREHAWK INDY 500 265/35R19 XL $228.01 20% $0.00 $182.41 012751 Passenger Firestone FIREHAWK INDY 500 275/35R19 XL $223.71 20% $0.00 $178.97 012802 Passenger Firestone FIREHAWK INDY 500 265/30R19 XL $239.41 20% $0.00 $191.53 012819 Passenger Firestone FIREHAWK INDY 500 275/30R19 XL $234.89 20% $0.00 $187.91 012836 Passenger Firestone FIREHAWK INDY 500 285/30R19 XL $259.78 20% $0.00 $207.82 012853 Passenger Firestone FIREHAWK INDY 500 245/45R20 XL $178.46 20% $0.00 $142.77 012870 Passenger Firestone FIREHAWK INDY 500 255/45R20 $185.58 20% $0.00 $148.46 012887 Passenger Firestone FIREHAWK INDY 500 245/40R20 XL $187.38 20% $0.00 $149.90 012921 Passenger Firestone FIREHAWK INDY 500 275/40R20 XL $218.97 20% $0.00 $175.17 012938 Passenger Firestone FIREHAWK INDY 500 255/35R20 XL $160.54 20% $0.00 $128.43 012972 Passenger Firestone FIREHAWK INDY 500 275/35R20 XL $235.47 20% $0.00 $188.37 012989 Passenger Firestone FIREHAWK INDY 500 285/30R20 XL $272.77 20% $0.00 $218.22 057333 Passenger Firestone FIREHAWK WIDE OVAL RFT P245/40R18 LL $233.05 20% $0.00 $186.43 057367 Passenger Firestone FIREHAWK WIDE OVAL RFT P285/35R19 LL $328.00 20% $0.00 $262.39 001278 Passenger Firestone FR710 P185/60R15 $101.26 20% $0.00 $81.01 002380 Passenger Firestone FR710 235/50R17 $150.38 20% $0.00 $120.31 003192 Passenger Firestone FR710 P185/65R15 $85.00 20% $0.00 $68.00 006505 Passenger Firestone FR710 P235/60R17 $130.74 20% $0.00 $104.60 047167 Passenger Firestone FR710 P215/70R15 $88.40 20% $0.00 $70.73 Page 13 of 5692 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 048136 Passenger Firestone FR710 215/65R16 $101.43 NET $0.00 $75.71 Discontinued w 066105 Passenger Firestone FR710 P215/55R17 $129.65 NET $0.00 $76.22 070355 Passenger Firestone FR710 P185/60R15 $84.30 NET $0.00 $58.46 Discontinued w 070372 Passenger Firestone FR710 P235/60R16 $109.63 NET $0.00 $76.01 084873 Passenger Firestone FR710 P225/55R17 $137.61 NET $0.00 $95.41 084890 Passenger Firestone FR710 P235/55R17 $146.82 NET $0.00 $101.80 Discontinued w 085808 Passenger Firestone FR710 P175/65R14 $81.07 NET $0.00 $51.89 085842 Passenger Firestone FR710 P185/65R15 $81.73 NET $0.00 $58.37 Discontinued w 085876 Passenger Firestone FR710 P205/55R16 $103.96 NET $0.00 $72.08 085927 Passenger Firestone FR710 P215/65R15 $93.08 NET $0.00 $64.52 085961 Passenger Firestone FR710 P215/60R16 $104.63 NET $0.00 $72.55 Discontinued w 112345 Passenger Firestone FR710 P215/60R16 $104.63 NET $0.00 $72.55 124653 Passenger Firestone FR710 P205/60R16 $99.33 NET $0.00 $68.86 Discontinued w 124670 Passenger Firestone FR710 P195/60R15 $88.26 NET $0.00 $63.50 Discontinued w 124687 Passenger Firestone FR710 235/65R16 $109.79 NET $0.00 $82.25 Discontinued w 124721 Passenger Firestone FR710 P215/60R17 $113.94 NET $0.00 $78.99 Discontinued w 124738 Passenger Firestone FR710 P205/50R16 $106.39 20% $0.00 $85.11 124755 Passenger Firestone FR710 P225/50R17 $139.04 NET $0.00 $96.41 Discontinued w 134037 Passenger Firestone FR710 P225/60R18 $140.11 NET $0.00 $79.49 138253 Passenger Firestone FR710 P225/65R17 $117.97 NET $0.00 $81.78 147977 Passenger Firestone FR710 P185/60R14 $83.42 20% $0.00 $66.74 148011 Passenger Firestone FR710 225/65R16 $104.85 NET $0.00 $72.70 Discontinued w 000593 Passenger Firestone FR740 P215/45R17 $141.29 20% $0.00 $113.03 001511 Passenger Firestone FR740 185/55R16 $118.69 20% $0.00 $94.95 001549 Passenger Firestone FR740 185/60R15 $103.51 20% $0.00 $82.81 000265 Passenger Firestone FT140 215/50R17 $103.56 20% $0.00 $82.85 000980 Passenger Firestone FT140 205/50R17 $114.01 20% $0.00 $91.20 003196 Passenger Firestone FT140 P205/65R16 $90.32 20% $0.00 $72.25 003208 Passenger Firestone FT140 205/65R16 $90.32 20% $0.00 $72.25 007148 Passenger Firestone FT140 P205/55R16 $109.61 20% $0.00 $87.69 021285 Passenger Firestone FT140 215/55R16 $114.18 20% $0.00 $91.34 005729 Passenger Bridgestone POTENZA RE040 215/45R17 $273.23 20% $0.00 $218.59 065187 Passenger Bridgestone POTENZA RE040 235/60R16 $304.26 20% $0.00 $243.41 093602 Passenger Bridgestone POTENZA RE040 RFT 275/40R18 $468.48 20% $0.00 $374.79 004638 Passenger Bridgestone POTENZA RE050 275/40ZR19 XL $485.71 20% $0.00 $388.57 119570 Passenger Bridgestone POTENZA RE050 255/40ZR19 XL $450.20 20% $0.00 $360.16 119423 Passenger Bridgestone POTENZA RE050 RFT 225/50R16 $286.87 20% $0.00 $229.50 000545 Passenger Bridgestone POTENZA RE050A 225/50R18 $304.89 20% $0.00 $243.91 000562 Passenger Bridgestone POTENZA RE050A 245/45R18 $328.59 20% $0.00 $262.87 000597 Passenger Bridgestone POTENZA RE050A 245/45R18 $328.59 20% $0.00 $262.87 001291 Passenger Bridgestone POTENZA RE050A 245/40R19 XL $432.89 20% $0.00 $346.31 001292 Passenger Bridgestone POTENZA RE050A 275/35R19 XL $436.75 20% $0.00 $349.40 001462 Passenger Bridgestone POTENZA RE050A 205/40R17 XL $263.39 20% $0.00 $210.72 003863 Passenger Bridgestone POTENZA RE050A 245/35R20 XL $439.79 20% $0.00 $351.83 003866 Passenger Bridgestone POTENZA RE050A 275/30R20 XL $481.51 20% $0.00 $385.21 004597 Passenger Bridgestone POTENZA RE050A 235/35R19 XL $369.37 20% $0.00 $295.50 007021 Passenger Bridgestone POTENZA RE050A 245/40ZR19 $418.26 20% $0.00 $334.61 007023 Passenger Bridgestone POTENZA RE050A 285/35ZR19 $443.09 20% $0.00 $354.47 024183 Passenger Bridgestone POTENZA RE050A 255/35ZR19 XL $415.67 20% $0.00 $332.54 024200 Passenger Bridgestone POTENZA RE050A 285/30ZR19 XL $451.89 20% $0.00 $361.51 024838 Passenger Bridgestone POTENZA RE050A 235/40R19 XL $419.92 20% $0.00 $335.94 024855 Passenger Bridgestone POTENZA RE050A 265/35R19 $411.63 20% $0.00 $329.31 038089 Passenger Bridgestone POTENZA RE050A 235/40ZR19 $405.71 20% $0.00 $324.57 056483 Passenger Bridgestone POTENZA RE050A 245/40R19 $418.26 20% $0.00 $334.61 056500 Passenger Bridgestone POTENZA RE050A 225/40R19 $393.55 20% $0.00 $314.84 056517 Passenger Bridgestone POTENZA RE050A 245/40R19 $418.26 20% $0.00 $334.61 071851 Passenger Bridgestone POTENZA RE050A 265/35R19 $411.63 20% $0.00 $329.31 112039 Passenger Bridgestone POTENZA RE050A 205/45R17 $242.37 20% $0.00 $193.90 112906 Passenger Bridgestone POTENZA RE050A 225/45R19 $362.46 20% $0.00 $289.97 119621 Passenger Bridgestone POTENZA RE050A 225/40R19 XL $405.35 20% $0.00 $324.28 119638 Passenger Bridgestone POTENZA RE050A 255/35R19 XL $415.67 20% $0.00 $332.54 127713 Passenger Bridgestone POTENZA RE050A 235/40ZR18 $311.11 20% $0.00 $248.89 127730 Passenger Bridgestone POTENZA RE050A 265/40ZR18 XL $398.98 20% $0.00 $319.18 127747 Passenger Bridgestone POTENZA RE050A 295/35ZR18 $502.93 20% $0.00 $402.34 127764 Passenger Bridgestone POTENZA RE050A 235/35ZR19 $369.37 20% $0.00 $295.50 127781 Passenger Bridgestone POTENZA RE050A 295/30ZR19 XL $469.96 20% $0.00 $375.97 127798 Passenger Bridgestone POTENZA RE050A 305/30ZR19 XL $494.49 20% $0.00 $395.59 133357 Passenger Bridgestone POTENZA RE050A 245/40R19 $418.26 20% $0.00 $334.61 133374 Passenger Bridgestone POTENZA RE050A 275/35R19 $421.98 20% $0.00 $337.58 133952 Passenger Bridgestone POTENZA RE050A 245/40ZR19 $418.26 20% $0.00 $334.61 133969 Passenger Bridgestone POTENZA RE050A 285/40ZR19 $488.06 20% $0.00 $390.44 140531 Passenger Bridgestone POTENZA RE050A 265/35ZR19 $411.63 20% $0.00 $329.31 140548 Passenger Bridgestone POTENZA RE050A 245/40R19 $418.26 20% $0.00 $334.61 140565 Passenger Bridgestone POTENZA RE050A 285/40R19 $488.06 20% $0.00 $390.44 142452 Passenger Bridgestone POTENZA RE050A 245/35ZR20 $424.91 20% $0.00 $339.93 142486 Passenger Bridgestone POTENZA RE050A 285/35ZR20 $467.10 20% $0.00 $373.68 149762 Passenger Bridgestone POTENZA RE050A 245/40R20 $439.16 20% $0.00 $351.33 021982 Passenger Bridgestone POTENZA RE050A ECOPIA 245/40R18 XL $377.66 20% $0.00 $302.13 021999 Passenger Bridgestone POTENZA RE050A ECOPIA 265/35R18 XL $430.12 20% $0.00 $344.10 141449 Passenger Bridgestone POTENZA RE050A I RFT 225/45R17 $312.44 20% $0.00 $249.95 141466 Passenger Bridgestone POTENZA RE050A I RFT 255/40R17 $373.48 20% $0.00 $298.79 141483 Passenger Bridgestone POTENZA RE050A I RFT 225/40R18 $371.38 20% $0.00 $297.11 141500 Passenger Bridgestone POTENZA RE050A I RFT 255/35R18 $453.71 20% $0.00 $362.97 141517 Passenger Bridgestone POTENZA RE050A I RFT 225/40R18 $371.38 20% $0.00 $297.11 141551 Passenger Bridgestone POTENZA RE050A I RFT 255/35R18 $453.71 20% $0.00 $362.97 141993 Passenger Bridgestone POTENZA RE050A I RFT 225/45R17 $287.56 20% $0.00 $230.04 142010 Passenger Bridgestone POTENZA RE050A I RFT 255/40R17 $343.60 20% $0.00 $274.88 067346 Passenger Bridgestone POTENZA RE050A II RFT 225/45R17 $287.56 20% $0.00 $230.04 068825 Passenger Bridgestone POTENZA RE050A II RFT 255/40R17 $343.60 20% $0.00 $274.88 135635 Passenger Bridgestone POTENZA RE050A MOEXTENDED 235/45R17 $324.92 20% $0.00 $259.94 135652 Passenger Bridgestone POTENZA RE050A MOEXTENDED 255/40R17 $373.48 20% $0.00 $298.79 104423 Passenger Bridgestone POTENZA RE050A PP RFT P325/30R19 LL $545.46 20% $0.00 $436.37 104440 Passenger Bridgestone POTENZA RE050A PP RFT P275/35R18 LL $440.13 20% $0.00 $352.11 000537 Passenger Bridgestone POTENZA RE050A RFT 245/35R20 XL $456.62 20% $0.00 $365.30 000539 Passenger Bridgestone POTENZA RE050A RFT 275/30R20 XL $539.31 20% $0.00 $431.45 001858 Passenger Bridgestone POTENZA RE050A RFT 225/40R18 XL $384.38 20% $0.00 $307.51 003827 Passenger Bridgestone POTENZA RE050A RFT 225/40RF18 $371.38 20% $0.00 $297.11 003828 Passenger Bridgestone POTENZA RE050A RFT 255/35RF18 $453.71 20% $0.00 $362.97 034094 Passenger Bridgestone POTENZA RE050A RFT 245/45R18 $411.80 20% $0.00 $329.44 034111 Passenger Bridgestone POTENZA RE050A RFT 275/40R18 $496.40 20% $0.00 $397.12 034128 Passenger Bridgestone POTENZA RE050A RFT 245/40R19 $524.21 20% $0.00 $419.37 034145 Passenger Bridgestone POTENZA RE050A RFT 275/35R19 $528.90 20% $0.00 $423.12 065952 Passenger Bridgestone POTENZA RE050A RFT 275/35R18 $506.75 20% $0.00 $405.40 Page 14 of 5693 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 068621 Passenger Bridgestone POTENZA RE050A RFT 205/45RF17 $297.32 20% $0.00 $237.86 069352 Passenger Bridgestone POTENZA RE050A RFT 275/35R18 $506.75 20% $0.00 $405.40 094903 Passenger Bridgestone POTENZA RE050A RFT 225/35R19 XL $436.46 20% $0.00 $349.17 094920 Passenger Bridgestone POTENZA RE050A RFT 255/30R19 XL $479.77 20% $0.00 $383.82 096535 Passenger Bridgestone POTENZA RE050A RFT 205/40R18 $349.42 20% $0.00 $279.54 106684 Passenger Bridgestone POTENZA RE050A RFT 245/35ZR20 $441.17 20% $0.00 $352.94 106701 Passenger Bridgestone POTENZA RE050A RFT 305/35ZR20 $542.62 20% $0.00 $434.10 118414 Passenger Bridgestone POTENZA RE050A RFT 215/40R18 $360.25 20% $0.00 $288.20 118431 Passenger Bridgestone POTENZA RE050A RFT 245/35R18 $435.58 20% $0.00 $348.46 119431 Passenger Bridgestone POTENZA RE050A RFT 225/40R18 $371.38 20% $0.00 $297.11 119458 Passenger Bridgestone POTENZA RE050A RFT 255/35R18 $453.71 20% $0.00 $362.97 144968 Passenger Bridgestone POTENZA RE050A RFT 245/40ZR19 $524.21 20% $0.00 $419.37 144985 Passenger Bridgestone POTENZA RE050A RFT 285/40ZR19 $564.30 20% $0.00 $451.44 005237 Passenger Bridgestone POTENZA RE050A RFT ECOPIA 225/45R17 $312.44 20% $0.00 $249.95 000927 Passenger Bridgestone POTENZA RE050A SCUDERIA 245/35ZR19 $402.43 20% $0.00 $321.94 000944 Passenger Bridgestone POTENZA RE050A SCUDERIA 345/35ZR19 $500.68 20% $0.00 $400.54 000426 Passenger Bridgestone POTENZA RE070 265/35ZR20 $554.54 20% $0.00 $443.63 001310 Passenger Bridgestone POTENZA RE070R R2 RFT 255/40ZRF20 $541.28 20% $0.00 $433.03 001327 Passenger Bridgestone POTENZA RE070R R2 RFT 285/35ZRF20 $601.71 20% $0.00 $481.37 126982 Passenger Bridgestone POTENZA RE070R RFT 255/40ZRF20 $541.28 20% $0.00 $433.03 127016 Passenger Bridgestone POTENZA RE070R RFT 285/35ZRF20 $601.71 20% $0.00 $481.37 000932 Passenger Bridgestone POTENZA RE-11 285/35R19 $375.91 20% $0.00 $300.74 000937 Passenger Bridgestone POTENZA RE-11 265/35R19 XL $370.54 20% $0.00 $296.44 000940 Passenger Bridgestone POTENZA RE-11 245/35R19 XL $342.60 20% $0.00 $274.09 146744 Passenger Bridgestone POTENZA RE71 RFT 235/45ZR17 $337.38 20% $0.00 $269.91 146761 Passenger Bridgestone POTENZA RE71 RFT 255/40ZR17 $364.91 20% $0.00 $291.93 002955 Passenger Bridgestone POTENZA RE-71R 265/45R18 XL $309.46 20% $0.00 $247.58 002962 Passenger Bridgestone POTENZA RE-71R 255/40R20 $318.78 20% $0.00 $255.03 002964 Passenger Bridgestone POTENZA RE-71R 235/45R18 $265.05 20% $0.00 $212.05 002966 Passenger Bridgestone POTENZA RE-71R 245/35R20 XL $357.58 20% $0.00 $286.07 002968 Passenger Bridgestone POTENZA RE-71R 295/30R20 XL $458.42 20% $0.00 $366.74 002970 Passenger Bridgestone POTENZA RE-71R 235/40R19 $280.68 20% $0.00 $224.55 002972 Passenger Bridgestone POTENZA RE-71R 265/40R19 $316.26 20% $0.00 $253.01 002974 Passenger Bridgestone POTENZA RE-71R 285/35R20 $405.60 20% $0.00 $324.49 002976 Passenger Bridgestone POTENZA RE-71R 225/35R19 XL $314.85 20% $0.00 $251.88 002978 Passenger Bridgestone POTENZA RE-71R 255/40R18 XL $280.04 20% $0.00 $224.03 002980 Passenger Bridgestone POTENZA RE-71R 215/40R18 XL $224.12 20% $0.00 $179.30 002982 Passenger Bridgestone POTENZA RE-71R 225/50R18 $237.90 20% $0.00 $190.32 002984 Passenger Bridgestone POTENZA RE-71R 205/50R16 $155.70 20% $0.00 $124.56 002986 Passenger Bridgestone POTENZA RE-71R 195/55R16 $165.75 20% $0.00 $132.60 009368 Passenger Bridgestone POTENZA RE-71R 195/50R15 $140.60 20% $0.00 $112.49 009402 Passenger Bridgestone POTENZA RE-71R 205/50R15 $146.45 20% $0.00 $117.17 009436 Passenger Bridgestone POTENZA RE-71R 205/55R16 $179.83 20% $0.00 $143.87 009453 Passenger Bridgestone POTENZA RE-71R 225/50R16 $175.98 20% $0.00 $140.79 009470 Passenger Bridgestone POTENZA RE-71R 205/45R16 XL $199.28 20% $0.00 $159.43 009521 Passenger Bridgestone POTENZA RE-71R 215/45R17 XL $174.16 20% $0.00 $139.33 009538 Passenger Bridgestone POTENZA RE-71R 225/45R17 XL $202.57 20% $0.00 $162.06 009572 Passenger Bridgestone POTENZA RE-71R 235/45R17 $197.62 20% $0.00 $158.10 009589 Passenger Bridgestone POTENZA RE-71R 245/45R17 $209.97 20% $0.00 $167.98 009606 Passenger Bridgestone POTENZA RE-71R 205/45R17 XL $203.79 20% $0.00 $163.04 009623 Passenger Bridgestone POTENZA RE-71R 215/45R18 XL $249.12 20% $0.00 $199.30 009640 Passenger Bridgestone POTENZA RE-71R 225/45R18 XL $259.51 20% $0.00 $207.61 009657 Passenger Bridgestone POTENZA RE-71R 245/45R18 XL $286.10 20% $0.00 $228.89 009674 Passenger Bridgestone POTENZA RE-71R 245/40R17 $216.15 20% $0.00 $172.93 009691 Passenger Bridgestone POTENZA RE-71R 255/40R17 XL $235.23 20% $0.00 $188.19 009742 Passenger Bridgestone POTENZA RE-71R 225/40R18 XL $233.45 20% $0.00 $186.76 009759 Passenger Bridgestone POTENZA RE-71R 235/40R18 XL $268.03 20% $0.00 $214.43 009793 Passenger Bridgestone POTENZA RE-71R 245/40R18 XL $269.28 20% $0.00 $215.43 009844 Passenger Bridgestone POTENZA RE-71R 255/35R18 XL $325.98 20% $0.00 $260.79 009861 Passenger Bridgestone POTENZA RE-71R 265/35R18 XL $338.77 20% $0.00 $271.02 009878 Passenger Bridgestone POTENZA RE-71R 275/35R18 $338.43 20% $0.00 $270.75 009912 Passenger Bridgestone POTENZA RE-71R 285/30R18 $369.56 20% $0.00 $295.66 009980 Passenger Bridgestone POTENZA RE-71R 245/40R19 XL $303.00 20% $0.00 $242.40 010048 Passenger Bridgestone POTENZA RE-71R 235/35R19 XL $327.44 20% $0.00 $261.95 010082 Passenger Bridgestone POTENZA RE-71R 245/35R19 XL $340.55 20% $0.00 $272.44 010099 Passenger Bridgestone POTENZA RE-71R 255/35R19 XL $355.86 20% $0.00 $284.69 010116 Passenger Bridgestone POTENZA RE-71R 275/35R19 $398.37 20% $0.00 $318.71 010133 Passenger Bridgestone POTENZA RE-71R 285/35R19 $386.29 20% $0.00 $309.04 010150 Passenger Bridgestone POTENZA RE-71R 265/35R19 XL $370.10 20% $0.00 $296.08 010184 Passenger Bridgestone POTENZA RE-71R 305/30R19 XL $452.92 20% $0.00 $362.34 079127 Passenger Bridgestone POTENZA RE760 SPORT 225/45R18 $219.09 20% $0.00 $175.27 079161 Passenger Bridgestone POTENZA RE760 SPORT 205/55R16 $150.69 20% $0.00 $120.56 079178 Passenger Bridgestone POTENZA RE760 SPORT 205/45R16 $149.76 20% $0.00 $119.81 079195 Passenger Bridgestone POTENZA RE760 SPORT 205/45R17 XL $152.55 20% $0.00 $122.04 079212 Passenger Bridgestone POTENZA RE760 SPORT 215/45R17 XL $179.27 20% $0.00 $143.42 079263 Passenger Bridgestone POTENZA RE760 SPORT 225/40R18 XL $204.48 20% $0.00 $163.59 079280 Passenger Bridgestone POTENZA RE760 SPORT 265/35R18 $260.49 20% $0.00 $208.39 079348 Passenger Bridgestone POTENZA RE760 SPORT 225/45R17 XL $184.65 20% $0.00 $147.72 079450 Passenger Bridgestone POTENZA RE760 SPORT 245/45R18 XL $235.53 20% $0.00 $188.42 079535 Passenger Bridgestone POTENZA RE760 SPORT 235/45R17 $198.58 20% $0.00 $158.87 079603 Passenger Bridgestone POTENZA RE760 SPORT 245/40R17 $208.80 20% $0.00 $167.04 079620 Passenger Bridgestone POTENZA RE760 SPORT 245/45R17 $202.56 20% $0.00 $162.05 079637 Passenger Bridgestone POTENZA RE760 SPORT 235/40R18 XL $214.04 20% $0.00 $171.23 079654 Passenger Bridgestone POTENZA RE760 SPORT 245/40R18 XL $228.94 20% $0.00 $183.15 079671 Passenger Bridgestone POTENZA RE760 SPORT 255/40R18 $235.47 20% $0.00 $188.37 079688 Passenger Bridgestone POTENZA RE760 SPORT 255/35R18 $252.69 20% $0.00 $202.15 102332 Passenger Bridgestone POTENZA RE760 SPORT 265/40R17 $222.72 20% $0.00 $178.18 102349 Passenger Bridgestone POTENZA RE760 SPORT 295/35R18 $329.06 20% $0.00 $263.25 108010 Passenger Bridgestone POTENZA RE760 SPORT 205/50R17 XL $178.18 20% $0.00 $142.54 121423 Passenger Bridgestone POTENZA RE760 SPORT 275/35R19 XL $305.47 20% $0.00 $244.38 121440 Passenger Bridgestone POTENZA RE760 SPORT 275/40R18 $277.04 20% $0.00 $221.64 121457 Passenger Bridgestone POTENZA RE760 SPORT 225/45R19 $253.72 20% $0.00 $202.97 121474 Passenger Bridgestone POTENZA RE760 SPORT 245/40R19 XL $292.85 20% $0.00 $234.28 139885 Passenger Bridgestone POTENZA RE760 SPORT 235/45R18 XL $226.12 20% $0.00 $180.90 072089 Passenger Bridgestone POTENZA RE92 225/45R17 $352.44 20% $0.00 $281.95 072106 Passenger Bridgestone POTENZA RE92 245/45R17 $384.13 20% $0.00 $307.30 087939 Passenger Bridgestone POTENZA RE92 P165/65R14 $106.79 20% $0.00 $85.43 133136 Passenger Bridgestone POTENZA RE92A 225/45R18 $272.63 20% $0.00 $218.10 133153 Passenger Bridgestone POTENZA RE92A 245/45R18 $300.58 20% $0.00 $240.46 073347 Passenger Bridgestone POTENZA RE92A RFT P265/50R20 $360.66 20% $0.00 $288.53 010473 Passenger Bridgestone POTENZA RE960AS PP RFT 275/35RF18 $381.47 20% $0.00 $305.18 010490 Passenger Bridgestone POTENZA RE960AS PP RFT 245/45RF18 $301.93 20% $0.00 $241.54 010507 Passenger Bridgestone POTENZA RE960AS PP RFT 245/45RF19 $317.82 20% $0.00 $254.26 Page 15 of 5694 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 010524 Passenger Bridgestone POTENZA RE960AS PP RFT 275/40RF19 $380.87 20% $0.00 $304.69 010541 Passenger Bridgestone POTENZA RE960AS PP RFT 225/55RF17 $240.54 20% $0.00 $192.43 010558 Passenger Bridgestone POTENZA RE960AS PP RFT 245/50RF18 $291.02 20% $0.00 $232.82 010575 Passenger Bridgestone POTENZA RE960AS PP RFT P245/45ZRF17 LL $288.27 20% $0.00 $230.62 010592 Passenger Bridgestone POTENZA RE960AS PP RFT P275/40ZRF18 LL $362.72 20% $0.00 $290.18 121236 Passenger Bridgestone POTENZA RE960AS PP RFT 225/45RF17 $255.87 20% $0.00 $204.70 145427 Passenger Bridgestone POTENZA RE960AS PP RFT 205/55RF16 $183.56 20% $0.00 $146.85 145444 Passenger Bridgestone POTENZA RE960AS PP RFT 205/45RF17 $223.53 20% $0.00 $178.82 145461 Passenger Bridgestone POTENZA RE960AS PP RFT 255/40RF17 $303.90 20% $0.00 $243.12 145478 Passenger Bridgestone POTENZA RE960AS PP RFT 245/40RF18 $350.06 20% $0.00 $280.05 145495 Passenger Bridgestone POTENZA RE960AS PP RFT 285/35RF19 $486.29 20% $0.00 $389.03 145512 Passenger Bridgestone POTENZA RE960AS PP RFT 195/55RF16 $176.21 20% $0.00 $140.97 145529 Passenger Bridgestone POTENZA RE960AS PP RFT 225/40RF18 $291.05 20% $0.00 $232.84 145546 Passenger Bridgestone POTENZA RE960AS PP RFT 255/35RF18 $380.17 20% $0.00 $304.14 010779 Passenger Bridgestone POTENZA RE970AS PP 235/55R17 $230.68 20% $0.00 $184.54 010915 Passenger Bridgestone POTENZA RE970AS PP 245/40R20 XL $372.24 20% $0.00 $297.79 010949 Passenger Bridgestone POTENZA RE970AS PP 255/35R20 XL $358.87 20% $0.00 $287.10 104508 Passenger Bridgestone POTENZA RE970AS PP 295/30R19 XL $426.32 20% $0.00 $341.06 104576 Passenger Bridgestone POTENZA RE970AS PP 285/30R20 XL $401.02 20% $0.00 $320.82 104627 Passenger Bridgestone POTENZA RE970AS PP 235/35R19 XL $310.60 20% $0.00 $248.48 104678 Passenger Bridgestone POTENZA RE970AS PP 275/35R18 $342.36 20% $0.00 $273.89 104695 Passenger Bridgestone POTENZA RE970AS PP 265/35R18 XL $321.68 20% $0.00 $257.34 105069 Passenger Bridgestone POTENZA RE970AS PP 245/45R17 XL $243.69 20% $0.00 $194.95 105120 Passenger Bridgestone POTENZA RE970AS PP 235/50R17 $242.83 20% $0.00 $194.26 105154 Passenger Bridgestone POTENZA RE970AS PP 215/50R17 XL $223.79 20% $0.00 $179.03 123361 Passenger Bridgestone POTENZA RE970AS PP 245/40R17 $251.70 20% $0.00 $201.36 123395 Passenger Bridgestone POTENZA RE970AS PP 235/40R18 XL $264.13 20% $0.00 $211.30 123429 Passenger Bridgestone POTENZA RE970AS PP 255/40R19 XL $385.31 20% $0.00 $308.24 123446 Passenger Bridgestone POTENZA RE970AS PP 245/45R19 $324.85 20% $0.00 $259.88 123463 Passenger Bridgestone POTENZA RE970AS PP 225/40R19 XL $321.45 20% $0.00 $257.16 123480 Passenger Bridgestone POTENZA RE970AS PP 275/40R19 $393.46 20% $0.00 $314.77 123497 Passenger Bridgestone POTENZA RE970AS PP 265/40R18 XL $312.77 20% $0.00 $250.21 123514 Passenger Bridgestone POTENZA RE970AS PP 225/50R18 $232.68 20% $0.00 $186.15 123531 Passenger Bridgestone POTENZA RE970AS PP 255/45R18 $296.63 20% $0.00 $237.30 123548 Passenger Bridgestone POTENZA RE970AS PP 255/40R18 XL $305.63 20% $0.00 $244.51 123582 Passenger Bridgestone POTENZA RE970AS PP 225/50R16 $192.40 20% $0.00 $153.92 123599 Passenger Bridgestone POTENZA RE970AS PP 275/35R20 XL $389.39 20% $0.00 $311.51 123684 Passenger Bridgestone POTENZA RE970AS PP 275/35R19 $392.49 20% $0.00 $313.99 123701 Passenger Bridgestone POTENZA RE970AS PP 255/35R18 XL $318.56 20% $0.00 $254.85 123718 Passenger Bridgestone POTENZA RE970AS PP 255/35R19 XL $345.22 20% $0.00 $276.18 139698 Passenger Bridgestone POTENZA RE970AS PP 215/45R18 XL $250.91 20% $0.00 $200.73 000168 Passenger Bridgestone POTENZA RE97AS 245/40R20 $252.84 20% $0.00 $202.27 000425 Passenger Bridgestone POTENZA RE97AS 245/40R20 $250.85 20% $0.00 $200.68 000894 Passenger Bridgestone POTENZA RE97AS 235/45R18 $211.39 20% $0.00 $169.11 003195 Passenger Bridgestone POTENZA RE97AS 225/40R18 XL $204.83 20% $0.00 $163.86 003829 Passenger Bridgestone POTENZA RE97AS P245/40R20 $250.85 20% $0.00 $200.68 004640 Passenger Bridgestone POTENZA RE97AS P245/40R20 $250.85 20% $0.00 $200.68 005839 Passenger Bridgestone POTENZA RE97AS P245/40R20 $234.44 20% $0.00 $187.55 008999 Passenger Bridgestone POTENZA RE97AS P255/35R20 XL $273.93 20% $0.00 $219.14 010966 Passenger Bridgestone POTENZA RE97AS 195/55R16 $141.75 20% $0.00 $113.40 010983 Passenger Bridgestone POTENZA RE97AS 205/55R16 $144.68 20% $0.00 $115.74 011000 Passenger Bridgestone POTENZA RE97AS 205/60R16 $141.60 20% $0.00 $113.28 011017 Passenger Bridgestone POTENZA RE97AS 215/55R16 XL $151.71 20% $0.00 $121.37 011034 Passenger Bridgestone POTENZA RE97AS 215/60R16 $151.67 20% $0.00 $121.34 011068 Passenger Bridgestone POTENZA RE97AS 225/55R16 $159.70 20% $0.00 $127.76 011085 Passenger Bridgestone POTENZA RE97AS 225/60R16 $156.11 20% $0.00 $124.89 011119 Passenger Bridgestone POTENZA RE97AS 205/50R17 XL $197.43 20% $0.00 $157.94 011136 Passenger Bridgestone POTENZA RE97AS 215/45R17 XL $190.23 20% $0.00 $152.18 011153 Passenger Bridgestone POTENZA RE97AS 215/50R17 XL $188.90 20% $0.00 $151.12 011170 Passenger Bridgestone POTENZA RE97AS 215/55R17 $192.93 20% $0.00 $154.35 011187 Passenger Bridgestone POTENZA RE97AS 225/45R17 XL $197.84 20% $0.00 $158.27 011204 Passenger Bridgestone POTENZA RE97AS 225/50R17 XL $205.05 20% $0.00 $164.04 011221 Passenger Bridgestone POTENZA RE97AS 225/55R17 $200.62 20% $0.00 $160.50 011238 Passenger Bridgestone POTENZA RE97AS 235/45R17 XL $205.75 20% $0.00 $164.60 011272 Passenger Bridgestone POTENZA RE97AS 245/40R17 $219.92 20% $0.00 $175.94 011289 Passenger Bridgestone POTENZA RE97AS 245/45R17 XL $211.48 20% $0.00 $169.18 011306 Passenger Bridgestone POTENZA RE97AS 225/40R18 XL $222.25 20% $0.00 $177.80 011323 Passenger Bridgestone POTENZA RE97AS 225/45R18 XL $215.59 20% $0.00 $172.47 011340 Passenger Bridgestone POTENZA RE97AS 225/60R18 $206.77 20% $0.00 $165.41 011357 Passenger Bridgestone POTENZA RE97AS 245/40R18 XL $245.03 20% $0.00 $196.03 011374 Passenger Bridgestone POTENZA RE97AS 245/45R18 XL $237.68 20% $0.00 $190.15 011391 Passenger Bridgestone POTENZA RE97AS 245/40R19 XL $285.12 20% $0.00 $228.10 013856 Passenger Bridgestone POTENZA RE97AS 225/50R18 $197.57 20% $0.00 $158.05 024889 Passenger Bridgestone POTENZA RE97AS 235/45R18 $202.93 20% $0.00 $162.34 000236 Passenger Bridgestone POTENZA RE97AS RFT P225/55RF17 $230.07 20% $0.00 $184.06 006574 Passenger Bridgestone POTENZA RE97AS RFT P255/35RF20 XL $380.47 20% $0.00 $304.37 008833 Passenger Bridgestone POTENZA RE97AS RFT P225/50RF18 $253.66 20% $0.00 $202.93 013924 Passenger Bridgestone POTENZA RE97AS RFT P245/45RF17 $242.52 20% $0.00 $194.02 008863 Passenger Bridgestone POTENZA RE97AS-02 225/45R18 XL $206.96 20% $0.00 $165.57 000112 Passenger Bridgestone POTENZA RE980AS 205/55R16 $127.93 20% $0.00 $102.34 000113 Passenger Bridgestone POTENZA RE980AS 225/45R17 XL $149.83 20% $0.00 $119.86 000114 Passenger Bridgestone POTENZA RE980AS 225/50R17 XL $180.93 20% $0.00 $144.74 000115 Passenger Bridgestone POTENZA RE980AS 235/45R17 XL $164.72 20% $0.00 $131.78 000117 Passenger Bridgestone POTENZA RE980AS 215/45R17 XL $160.91 20% $0.00 $128.73 000118 Passenger Bridgestone POTENZA RE980AS 225/40R18 XL $174.69 20% $0.00 $139.76 000120 Passenger Bridgestone POTENZA RE980AS 245/45R18 XL $219.14 20% $0.00 $175.31 000122 Passenger Bridgestone POTENZA RE980AS 245/40R18 XL $227.42 20% $0.00 $181.94 000125 Passenger Bridgestone POTENZA RE980AS 245/40R17 $185.05 20% $0.00 $148.04 000126 Passenger Bridgestone POTENZA RE980AS 235/50R18 $200.72 20% $0.00 $160.57 000127 Passenger Bridgestone POTENZA RE980AS 225/45R18 $206.32 20% $0.00 $165.06 000128 Passenger Bridgestone POTENZA RE980AS 245/40R19 XL $260.69 20% $0.00 $208.55 000133 Passenger Bridgestone POTENZA RE980AS 245/45R20 XL $283.59 20% $0.00 $226.87 000139 Passenger Bridgestone POTENZA RE980AS 235/45R18 XL $221.46 20% $0.00 $177.17 000143 Passenger Bridgestone POTENZA RE980AS 245/45R19 $252.14 20% $0.00 $201.71 000148 Passenger Bridgestone POTENZA RE980AS 245/35R19 XL $241.14 20% $0.00 $192.91 001302 Passenger Bridgestone POTENZA S001 245/40R19 XL $432.20 20% $0.00 $345.76 001303 Passenger Bridgestone POTENZA S001 285/35R19 $497.83 20% $0.00 $398.26 001633 Passenger Bridgestone POTENZA S001 255/40ZR20 XL $472.73 20% $0.00 $378.18 001650 Passenger Bridgestone POTENZA S001 295/35ZR20 XL $502.79 20% $0.00 $402.23 001971 Passenger Bridgestone POTENZA S001 225/40R18 XL $306.70 20% $0.00 $245.36 002045 Passenger Bridgestone POTENZA S001 215/45R20 XL $382.04 20% $0.00 $305.63 002046 Passenger Bridgestone POTENZA S001 245/40R20 XL $454.54 20% $0.00 $363.63 002109 Passenger Bridgestone POTENZA S001 275/30R20 XL $464.87 20% $0.00 $371.90 Page 16 of 5695 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 002448 Passenger Bridgestone POTENZA S001 235/40R19 XL $414.91 20% $0.00 $331.93 002772 Passenger Bridgestone POTENZA S001 265/35ZR20 $468.84 20% $0.00 $375.07 002789 Passenger Bridgestone POTENZA S001 305/30ZR20 $540.09 20% $0.00 $432.07 004663 Passenger Bridgestone POTENZA S001 205/45R17 $246.17 20% $0.00 $196.94 004804 Passenger Bridgestone POTENZA S001 245/35R19 XL $453.81 20% $0.00 $363.04 004857 Passenger Bridgestone POTENZA S001 245/40R18 XL $331.73 20% $0.00 $265.39 007034 Passenger Bridgestone POTENZA S001 265/35ZR20 $468.84 20% $0.00 $375.07 007035 Passenger Bridgestone POTENZA S001 235/35ZR20 $429.31 20% $0.00 $343.45 009000 Passenger Bridgestone POTENZA S001 255/35R20 XL $428.09 20% $0.00 $342.47 009001 Passenger Bridgestone POTENZA S001 275/30R20 XL $464.87 20% $0.00 $371.90 024617 Passenger Bridgestone POTENZA S001 225/35R18 XL $320.59 20% $0.00 $256.47 024753 Passenger Bridgestone POTENZA S001 225/40R18 XL $306.70 20% $0.00 $245.36 024770 Passenger Bridgestone POTENZA S001 245/35R18 XL $348.32 20% $0.00 $278.65 025042 Passenger Bridgestone POTENZA S001 295/35ZR20 $502.79 20% $0.00 $402.23 025144 Passenger Bridgestone POTENZA S001 255/40R19 XL $450.20 20% $0.00 $360.16 025161 Passenger Bridgestone POTENZA S001 255/35R20 XL $428.09 20% $0.00 $342.47 139783 Passenger Bridgestone POTENZA S001 245/35R20 XL $439.79 20% $0.00 $351.83 144951 Passenger Bridgestone POTENZA S001 295/35ZR20 $545.86 20% $0.00 $436.69 145291 Passenger Bridgestone POTENZA S001 235/35ZR20 $429.31 20% $0.00 $343.45 149711 Passenger Bridgestone POTENZA S001 245/40ZR20 $439.16 20% $0.00 $351.33 149728 Passenger Bridgestone POTENZA S001 295/35ZR20 XL $502.79 20% $0.00 $402.23 002047 Passenger Bridgestone POTENZA S001 I 195/50R20 XL $334.48 20% $0.00 $267.59 002048 Passenger Bridgestone POTENZA S001 I 215/45R20 XL $382.04 20% $0.00 $305.63 000257 Passenger Bridgestone POTENZA S001 MOE 255/35R19 XL $493.07 20% $0.00 $394.45 000258 Passenger Bridgestone POTENZA S001 MOE 285/30R19 XL $582.36 20% $0.00 $465.89 000259 Passenger Bridgestone POTENZA S001 MOE 255/40R18 XL $442.87 20% $0.00 $354.30 000260 Passenger Bridgestone POTENZA S001 MOE 285/35R18 $509.55 20% $0.00 $407.64 001768 Passenger Bridgestone POTENZA S001 MOEXTENDED 245/50R18 $370.27 20% $0.00 $296.22 001769 Passenger Bridgestone POTENZA S001 MOEXTENDED 245/45R19 XL $424.10 20% $0.00 $339.28 001770 Passenger Bridgestone POTENZA S001 MOEXTENDED 275/40R19 $483.38 20% $0.00 $386.70 003649 Passenger Bridgestone POTENZA S001 MOEXTENDED 225/45R18 XL $371.31 20% $0.00 $297.05 003650 Passenger Bridgestone POTENZA S001 MOEXTENDED 245/40R18 XL $425.15 20% $0.00 $340.12 004801 Passenger Bridgestone POTENZA S001 RFT 245/40R20 XL $472.18 20% $0.00 $377.74 004802 Passenger Bridgestone POTENZA S001 RFT 275/35R20 XL $559.10 20% $0.00 $447.28 004815 Passenger Bridgestone POTENZA S001 RFT 245/35R18 XL $450.82 20% $0.00 $360.65 004838 Passenger Bridgestone POTENZA S001 RFT 225/40R18 XL $412.45 20% $0.00 $329.96 004841 Passenger Bridgestone POTENZA S001 RFT 245/50R18 $372.52 20% $0.00 $298.02 004847 Passenger Bridgestone POTENZA S001 RFT 225/40R19 XL $414.42 20% $0.00 $331.54 004848 Passenger Bridgestone POTENZA S001 RFT 255/35R19 XL $493.07 20% $0.00 $394.45 004849 Passenger Bridgestone POTENZA S001 RFT 245/45R19 $412.76 20% $0.00 $330.21 004850 Passenger Bridgestone POTENZA S001 RFT 275/40R19 $487.16 20% $0.00 $389.73 004851 Passenger Bridgestone POTENZA S001 RFT 225/45R19 $380.39 20% $0.00 $304.31 004853 Passenger Bridgestone POTENZA S001 RFT 225/40R18 XL $412.45 20% $0.00 $329.96 004855 Passenger Bridgestone POTENZA S001 RFT 225/35R19 XL $454.73 20% $0.00 $363.78 006575 Passenger Bridgestone POTENZA S001 RFT 255/35RF20 XL $517.73 20% $0.00 $414.18 006576 Passenger Bridgestone POTENZA S001 RFT 275/30RF20 XL $587.05 20% $0.00 $469.64 006909 Passenger Bridgestone POTENZA S001 RFT 225/40R19 $399.92 20% $0.00 $319.94 006910 Passenger Bridgestone POTENZA S001 RFT 255/35R19 $475.81 20% $0.00 $380.65 023767 Passenger Bridgestone POTENZA S001 RFT 225/45R17 $312.44 20% $0.00 $249.95 023784 Passenger Bridgestone POTENZA S001 RFT 245/40R17 $361.67 20% $0.00 $289.34 023818 Passenger Bridgestone POTENZA S001 RFT 245/35R18 $435.58 20% $0.00 $348.46 023835 Passenger Bridgestone POTENZA S001 RFT 255/35R19 $476.40 20% $0.00 $381.12 023852 Passenger Bridgestone POTENZA S001 RFT 205/50R17 $293.39 20% $0.00 $234.71 023869 Passenger Bridgestone POTENZA S001 RFT 225/40R18 $398.50 20% $0.00 $318.80 023886 Passenger Bridgestone POTENZA S001 RFT 225/40R19 $400.42 20% $0.00 $320.33 024685 Passenger Bridgestone POTENZA S001 RFT 225/50R17 $321.33 20% $0.00 $257.06 024702 Passenger Bridgestone POTENZA S001 RFT 255/45R17 $358.81 20% $0.00 $287.04 024719 Passenger Bridgestone POTENZA S001 RFT 225/45R18 $379.52 20% $0.00 $303.62 024736 Passenger Bridgestone POTENZA S001 RFT 255/40R18 $427.89 20% $0.00 $342.31 005973 Passenger Bridgestone POTENZA S001L RFT 275/35RF21 $587.05 20% $0.00 $469.64 007212 Passenger Bridgestone POTENZA S001L RFT 245/40RF21 $495.79 20% $0.00 $396.63 001443 Passenger Bridgestone POTENZA S007 255/35ZR20 $413.10 20% $0.00 $330.48 001444 Passenger Bridgestone POTENZA S007 315/35ZR20 $533.61 20% $0.00 $426.89 002600 Passenger Bridgestone POTENZA S007 265/30ZR20 XL $443.55 20% $0.00 $354.84 007024 Passenger Bridgestone POTENZA S007 255/40ZR20 XL $413.10 20% $0.00 $330.48 007025 Passenger Bridgestone POTENZA S007 295/35ZR20 XL $510.56 20% $0.00 $408.45 007097 Passenger Bridgestone POTENZA S007 215/45R18 XL $346.61 20% $0.00 $277.28 009044 Passenger Bridgestone POTENZA S007 245/40R19 $357.92 20% $0.00 $286.33 009046 Passenger Bridgestone POTENZA S007 275/35R19 $416.32 20% $0.00 $333.05 006381 Passenger Bridgestone POTENZA S007 245/35ZR20 XL $396.58 20% $0.00 $317.27 007033 Passenger Bridgestone POTENZA S007 305/30ZR20 XL $557.53 20% $0.00 $446.02 001477 Passenger Bridgestone POTENZA S007 RFT 255/35ZR20 $500.22 20% $0.00 $400.18 001478 Passenger Bridgestone POTENZA S007 RFT 315/35ZR20 $631.93 20% $0.00 $505.54 004692 Passenger Bridgestone POTENZA S007 RFT 245/35ZR20 $520.23 20% $0.00 $416.18 004693 Passenger Bridgestone POTENZA S007 RFT 285/35ZR20 $560.25 20% $0.00 $448.20 057118 Passenger Bridgestone POTENZA S-02 205/55ZR16 $288.31 20% $0.00 $230.65 057126 Passenger Bridgestone POTENZA S-02 225/50ZR16 $248.96 20% $0.00 $199.17 004007 Passenger Bridgestone POTENZA S-02A 205/50ZR17 $265.70 20% $0.00 $212.56 024285 Passenger Bridgestone POTENZA S-02A 295/30ZR18 XL $554.43 20% $0.00 $443.55 038072 Passenger Bridgestone POTENZA S-02A 265/35ZR18 $411.14 20% $0.00 $328.92 087955 Passenger Bridgestone POTENZA S-02A 215/45ZR18 $317.49 20% $0.00 $253.99 119296 Passenger Bridgestone POTENZA S-02A 255/40R17 $333.25 20% $0.00 $266.60 146693 Passenger Bridgestone POTENZA S-02A 225/40ZR18 $313.34 20% $0.00 $250.67 146710 Passenger Bridgestone POTENZA S-02A 285/30ZR18 $528.02 20% $0.00 $422.42 001209 Passenger Bridgestone POTENZA S-04 PP 295/30R20 XL $457.12 20% $0.00 $365.69 001210 Passenger Bridgestone POTENZA S-04 PP 235/45R18 $296.82 20% $0.00 $237.46 001211 Passenger Bridgestone POTENZA S-04 PP 265/45R18 $333.66 20% $0.00 $266.93 001212 Passenger Bridgestone POTENZA S-04 PP 235/40R19 $353.95 20% $0.00 $283.16 001213 Passenger Bridgestone POTENZA S-04 PP 265/40R19 $420.50 20% $0.00 $336.40 001214 Passenger Bridgestone POTENZA S-04 PP 245/35R20 $378.36 20% $0.00 $302.68 102638 Passenger Bridgestone POTENZA S-04 PP 205/50R17 XL $230.03 20% $0.00 $184.03 102655 Passenger Bridgestone POTENZA S-04 PP 205/45R17 XL $210.64 20% $0.00 $168.51 102672 Passenger Bridgestone POTENZA S-04 PP 225/45R17 $228.26 20% $0.00 $182.60 102689 Passenger Bridgestone POTENZA S-04 PP 225/45R18 $285.40 20% $0.00 $228.32 102706 Passenger Bridgestone POTENZA S-04 PP 235/45R17 $244.83 20% $0.00 $195.86 102740 Passenger Bridgestone POTENZA S-04 PP 245/45R18 $305.57 20% $0.00 $244.45 102757 Passenger Bridgestone POTENZA S-04 PP 225/40R18 XL $279.83 20% $0.00 $223.86 102774 Passenger Bridgestone POTENZA S-04 PP 245/40R17 $271.01 20% $0.00 $216.81 102791 Passenger Bridgestone POTENZA S-04 PP 245/40R18 XL $314.77 20% $0.00 $251.82 102808 Passenger Bridgestone POTENZA S-04 PP 245/40R19 XL $367.48 20% $0.00 $293.98 102825 Passenger Bridgestone POTENZA S-04 PP 245/40R20 XL $414.89 20% $0.00 $331.91 102842 Passenger Bridgestone POTENZA S-04 PP 255/40R17 $293.40 20% $0.00 $234.72 102859 Passenger Bridgestone POTENZA S-04 PP 255/40R18 XL $330.50 20% $0.00 $264.40 Page 17 of 5696 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 102995 Passenger Bridgestone POTENZA S-04 PP 235/35R19 XL $331.01 20% $0.00 $264.81 103029 Passenger Bridgestone POTENZA S-04 PP 245/35R19 XL $348.46 20% $0.00 $278.77 103080 Passenger Bridgestone POTENZA S-04 PP 255/35R18 XL $332.39 20% $0.00 $265.91 103097 Passenger Bridgestone POTENZA S-04 PP 255/35R20 XL $394.12 20% $0.00 $315.29 103114 Passenger Bridgestone POTENZA S-04 PP 265/35R18 XL $344.66 20% $0.00 $275.73 103131 Passenger Bridgestone POTENZA S-04 PP 275/35R18 $354.64 20% $0.00 $283.71 103148 Passenger Bridgestone POTENZA S-04 PP 275/35R19 XL $406.63 20% $0.00 $325.30 103165 Passenger Bridgestone POTENZA S-04 PP 285/35R18 XL $413.82 20% $0.00 $331.05 103301 Passenger Bridgestone POTENZA S-04 PP 285/30R18 $464.90 20% $0.00 $371.92 103318 Passenger Bridgestone POTENZA S-04 PP 285/30R20 XL $439.53 20% $0.00 $351.62 120743 Passenger Bridgestone POTENZA S-04 PP 205/55R16 $200.92 20% $0.00 $160.74 120777 Passenger Bridgestone POTENZA S-04 PP 215/45R17 XL $216.67 20% $0.00 $173.34 120794 Passenger Bridgestone POTENZA S-04 PP 235/50R17 $244.84 20% $0.00 $195.87 120811 Passenger Bridgestone POTENZA S-04 PP 215/45R18 XL $250.04 20% $0.00 $200.03 120828 Passenger Bridgestone POTENZA S-04 PP 225/50R18 $224.75 20% $0.00 $179.80 120845 Passenger Bridgestone POTENZA S-04 PP 235/40R18 XL $287.79 20% $0.00 $230.23 120862 Passenger Bridgestone POTENZA S-04 PP 245/35R18 XL $322.42 20% $0.00 $257.94 120879 Passenger Bridgestone POTENZA S-04 PP 255/45R18 $320.83 20% $0.00 $256.67 120930 Passenger Bridgestone POTENZA S-04 PP 225/40R19 XL $352.68 20% $0.00 $282.14 120947 Passenger Bridgestone POTENZA S-04 PP 225/45R19 XL $294.17 20% $0.00 $235.34 120964 Passenger Bridgestone POTENZA S-04 PP 245/45R19 $316.24 20% $0.00 $252.99 120981 Passenger Bridgestone POTENZA S-04 PP 255/35R19 XL $358.95 20% $0.00 $287.16 120998 Passenger Bridgestone POTENZA S-04 PP 255/40R19 XL $419.14 20% $0.00 $335.32 121015 Passenger Bridgestone POTENZA S-04 PP 265/35R19 XL $387.00 20% $0.00 $309.60 121032 Passenger Bridgestone POTENZA S-04 PP 275/40R19 $438.02 20% $0.00 $350.42 121049 Passenger Bridgestone POTENZA S-04 PP 285/30R19 XL $420.72 20% $0.00 $336.58 121066 Passenger Bridgestone POTENZA S-04 PP 285/35R19 $412.53 20% $0.00 $330.02 121151 Passenger Bridgestone POTENZA S-04 PP 275/35R20 XL $432.81 20% $0.00 $346.24 124143 Passenger Bridgestone POTENZA S-04 PP 265/40R18 XL $345.46 20% $0.00 $276.37 139834 Passenger Bridgestone POTENZA S-04 PP 295/30R19 XL $437.55 20% $0.00 $350.04 139851 Passenger Bridgestone POTENZA S-04 PP 305/30R19 XL $463.84 20% $0.00 $371.07 006547 Passenger Firestone RADIAL TEMPA SPARE P265/70R17 $131.54 20% $0.00 $105.23 125231 Passenger Bridgestone TURANZA EL400 RFT P225/60RF17 $208.76 20% $0.00 $167.01 000533 Passenger Bridgestone TURANZA EL400-02 P215/45R17 $211.89 20% $0.00 $169.52 001453 Passenger Bridgestone TURANZA EL400-02 255/35R18 $350.43 20% $0.00 $280.35 005152 Passenger Bridgestone TURANZA EL400-02 P225/65R16 $140.92 20% $0.00 $112.74 005186 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 023342 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 023478 Passenger Bridgestone TURANZA EL400-02 P175/65R15 $126.75 20% $0.00 $101.41 023495 Passenger Bridgestone TURANZA EL400-02 P195/50R16 $169.98 20% $0.00 $135.99 023512 Passenger Bridgestone TURANZA EL400-02 P205/60R16 $165.23 20% $0.00 $132.19 024804 Passenger Bridgestone TURANZA EL400-02 235/40R19 XL $314.32 20% $0.00 $251.47 053916 Passenger Bridgestone TURANZA EL400-02 205/55R16 $163.91 20% $0.00 $131.13 053950 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 054001 Passenger Bridgestone TURANZA EL400-02 P215/60R16 $172.13 20% $0.00 $137.71 057911 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 090160 Passenger Bridgestone TURANZA EL400-02 P245/50R17 $249.35 20% $0.00 $199.49 093458 Passenger Bridgestone TURANZA EL400-02 P195/55R16 $161.89 20% $0.00 $129.52 108571 Passenger Bridgestone TURANZA EL400-02 P205/60R16 $165.23 20% $0.00 $132.19 108605 Passenger Bridgestone TURANZA EL400-02 P215/50R17 $221.66 20% $0.00 $177.34 108622 Passenger Bridgestone TURANZA EL400-02 P225/50R17 $230.90 20% $0.00 $184.72 112294 Passenger Bridgestone TURANZA EL400-02 195/60R16 $154.69 20% $0.00 $123.76 112702 Passenger Bridgestone TURANZA EL400-02 P225/65R17 $154.36 20% $0.00 $123.49 112872 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 124823 Passenger Bridgestone TURANZA EL400-02 235/60R17 $164.36 20% $0.00 $131.49 131674 Passenger Bridgestone TURANZA EL400-02 P215/55R17 $215.21 20% $0.00 $172.17 131691 Passenger Bridgestone TURANZA EL400-02 P225/45R18 $264.87 20% $0.00 $211.90 132677 Passenger Bridgestone TURANZA EL400-02 225/40R18 $296.20 20% $0.00 $236.97 132694 Passenger Bridgestone TURANZA EL400-02 255/40R18 $333.74 20% $0.00 $267.00 133255 Passenger Bridgestone TURANZA EL400-02 P205/55R16 $163.91 20% $0.00 $131.13 140106 Passenger Bridgestone TURANZA EL400-02 P215/45R17 $211.89 20% $0.00 $169.52 000460 Passenger Bridgestone TURANZA EL400-02 ECOPIA P205/55R16 $163.91 20% $0.00 $131.13 000477 Passenger Bridgestone TURANZA EL400-02 ECOPIA P205/60R15 $144.02 20% $0.00 $115.22 001729 Passenger Bridgestone TURANZA EL400-02 MOE 245/50R18 $250.66 20% $0.00 $200.53 002738 Passenger Bridgestone TURANZA EL400-02 MOE 245/45R17 $251.29 20% $0.00 $201.03 000237 Passenger Bridgestone TURANZA EL400-02 RFT 205/50R17 $200.55 20% $0.00 $160.44 004434 Passenger Bridgestone TURANZA EL400-02 RFT 235/55RF18 $258.45 20% $0.00 $206.76 017834 Passenger Bridgestone TURANZA EL400-02 RFT 225/50R17 $216.91 20% $0.00 $173.53 135601 Passenger Bridgestone TURANZA EL400-02 RFT 205/50R17 $192.84 20% $0.00 $154.27 142503 Passenger Bridgestone TURANZA EL400-02 RFT 255/40RF18 $370.12 20% $0.00 $296.09 142520 Passenger Bridgestone TURANZA EL400-02 RFT 225/40RF18 $328.51 20% $0.00 $262.81 007906 Passenger Bridgestone TURANZA EL42 P245/45R19 $362.02 20% $0.00 $289.62 093492 Passenger Bridgestone TURANZA EL42 P235/50R18 $313.33 20% $0.00 $250.66 112311 Passenger Bridgestone TURANZA EL42 P245/45R19 $362.02 20% $0.00 $289.62 132762 Passenger Bridgestone TURANZA EL42 P235/50R18 $313.33 20% $0.00 $250.66 147169 Passenger Bridgestone TURANZA EL42 P205/65R16 $132.67 20% $0.00 $106.14 000009 Passenger Bridgestone TURANZA EL42 RFT 245/50R18 $407.62 20% $0.00 $326.09 096824 Passenger Bridgestone TURANZA EL42 RFT 225/45R17 $301.83 20% $0.00 $241.47 116833 Passenger Bridgestone TURANZA EL42 RFT 205/55R16 $245.40 20% $0.00 $196.32 000216 Passenger Bridgestone TURANZA EL440 235/60R18 $220.89 20% $0.00 $176.72 000220 Passenger Bridgestone TURANZA EL440 235/45R18 $258.41 20% $0.00 $206.73 000221 Passenger Bridgestone TURANZA EL440 235/40R19 $282.18 20% $0.00 $225.75 002358 Passenger Bridgestone TURANZA EL440 235/60R18 $220.89 20% $0.00 $176.72 002359 Passenger Bridgestone TURANZA EL440 235/55R19 $243.52 20% $0.00 $194.82 004699 Passenger Bridgestone TURANZA EL450 RFT 245/45R19 XL $414.54 20% $0.00 $331.63 006373 Passenger Bridgestone TURANZA EL450 RFT 225/50R18 $229.02 20% $0.00 $183.22 006374 Passenger Bridgestone TURANZA EL450 RFT 225/45R18 $238.28 20% $0.00 $190.62 006375 Passenger Bridgestone TURANZA EL450 RFT 225/50R17 $217.56 20% $0.00 $174.05 008860 Passenger Bridgestone TURANZA EL450 RFT 245/45RF20 $456.83 20% $0.00 $365.47 008861 Passenger Bridgestone TURANZA EL450 RFT 275/40RF20 $539.56 20% $0.00 $431.65 002092 Passenger Bridgestone TURANZA EL470 P195/55R16 $174.26 20% $0.00 $139.41 110186 Passenger Bridgestone TURANZA EL470 185/55R16 $153.65 20% $0.00 $122.92 004065 Passenger Bridgestone TURANZA ER30 255/50R19 $377.32 20% $0.00 $301.85 118869 Passenger Bridgestone TURANZA ER30 245/50R18 $340.16 20% $0.00 $272.13 003662 Passenger Bridgestone TURANZA ER300 205/55R16 $196.95 20% $0.00 $157.56 021829 Passenger Bridgestone TURANZA ER300 245/45R18 XL $329.87 20% $0.00 $263.90 021846 Passenger Bridgestone TURANZA ER300 225/45R17 $280.18 20% $0.00 $224.15 149660 Passenger Bridgestone TURANZA ER300 195/55R16 $167.09 20% $0.00 $133.68 000623 Passenger Bridgestone TURANZA ER300 RFT 245/40R19 $442.81 20% $0.00 $354.25 000631 Passenger Bridgestone TURANZA ER300 RFT 275/35R19 $523.01 20% $0.00 $418.41 001783 Passenger Bridgestone TURANZA ER300 RFT 245/45R18 $403.85 20% $0.00 $323.08 001784 Passenger Bridgestone TURANZA ER300 RFT 275/40R18 $476.98 20% $0.00 $381.59 132830 Passenger Bridgestone TURANZA ER300-2 RFT 195/55R16 $179.51 20% $0.00 $143.61 Page 18 of 5697 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 132847 Passenger Bridgestone TURANZA ER300-2 RFT 195/55R16 $195.11 20% $0.00 $156.09 023682 Passenger Bridgestone TURANZA ER300A RFT 205/55R16 $212.27 20% $0.00 $169.81 000984 Passenger Bridgestone TURANZA ER33 245/45R18 $374.23 20% $0.00 $299.38 001454 Passenger Bridgestone TURANZA ER33 255/35R18 $375.91 20% $0.00 $300.73 003386 Passenger Bridgestone TURANZA ER33 215/50R17 $274.47 20% $0.00 $219.57 025093 Passenger Bridgestone TURANZA ER33 225/50R17 $297.82 20% $0.00 $238.25 025110 Passenger Bridgestone TURANZA ER33 235/45R18 $359.86 20% $0.00 $287.88 093526 Passenger Bridgestone TURANZA ER33 245/45R19 $393.36 20% $0.00 $314.69 108163 Passenger Bridgestone TURANZA ER33 255/40R18 $358.02 20% $0.00 $286.41 108180 Passenger Bridgestone TURANZA ER33 225/40R18 $327.56 20% $0.00 $262.05 132779 Passenger Bridgestone TURANZA ER33 235/50R18 $326.56 20% $0.00 $261.25 003818 Passenger Bridgestone TURANZA ER33 RFT 245/45RF19 $431.82 20% $0.00 $345.46 006539 Passenger Bridgestone TURANZA ER33 RFT 225/45R17 $360.06 20% $0.00 $288.05 090381 Passenger Bridgestone TURANZA ER33 RFT 245/40RF18 $432.90 20% $0.00 $346.32 003240 Passenger Bridgestone TURANZA SERENITY PLUS 255/45R19 XL $415.44 20% $0.00 $332.37 003241 Passenger Bridgestone TURANZA SERENITY PLUS 235/45R18 $297.43 20% $0.00 $237.95 003242 Passenger Bridgestone TURANZA SERENITY PLUS 245/45R17 XL $278.98 20% $0.00 $223.19 003344 Passenger Bridgestone TURANZA SERENITY PLUS 245/45R20 XL $399.73 20% $0.00 $319.80 010609 Passenger Bridgestone TURANZA SERENITY PLUS 235/55R18 $252.28 20% $0.00 $201.83 106055 Passenger Bridgestone TURANZA SERENITY PLUS 255/40R19 XL $432.74 20% $0.00 $346.21 106106 Passenger Bridgestone TURANZA SERENITY PLUS 235/40R18 XL $341.37 20% $0.00 $273.11 106140 Passenger Bridgestone TURANZA SERENITY PLUS 245/40R18 $343.05 20% $0.00 $274.45 106174 Passenger Bridgestone TURANZA SERENITY PLUS 245/45R18 $325.74 20% $0.00 $260.60 106191 Passenger Bridgestone TURANZA SERENITY PLUS 275/40R19 XL $478.76 20% $0.00 $383.03 106225 Passenger Bridgestone TURANZA SERENITY PLUS 255/45R18 XL $369.53 20% $0.00 $295.64 106242 Passenger Bridgestone TURANZA SERENITY PLUS 245/45R19 $381.31 20% $0.00 $305.06 106259 Passenger Bridgestone TURANZA SERENITY PLUS 235/50R18 $297.43 20% $0.00 $237.95 106276 Passenger Bridgestone TURANZA SERENITY PLUS 235/45R17 $240.88 20% $0.00 $192.71 106293 Passenger Bridgestone TURANZA SERENITY PLUS 225/45R17 $231.62 20% $0.00 $185.31 106310 Passenger Bridgestone TURANZA SERENITY PLUS 225/50R17 $232.61 20% $0.00 $186.10 106480 Passenger Bridgestone TURANZA SERENITY PLUS 215/55R16 $172.65 20% $0.00 $138.13 106497 Passenger Bridgestone TURANZA SERENITY PLUS 205/55R16 $168.36 20% $0.00 $134.70 106531 Passenger Bridgestone TURANZA SERENITY PLUS 225/60R16 $173.30 20% $0.00 $138.65 106616 Passenger Bridgestone TURANZA SERENITY PLUS 195/60R15 $148.13 20% $0.00 $118.51 106633 Passenger Bridgestone TURANZA SERENITY PLUS 205/65R15 $146.29 20% $0.00 $117.04 106650 Passenger Bridgestone TURANZA SERENITY PLUS 195/65R15 $141.07 20% $0.00 $112.86 146855 Passenger Bridgestone TURANZA SERENITY PLUS 225/55R16 $209.49 20% $0.00 $167.60 146906 Passenger Bridgestone TURANZA SERENITY PLUS 215/55R17 $221.47 20% $0.00 $177.18 146940 Passenger Bridgestone TURANZA SERENITY PLUS 225/55R17 $231.55 20% $0.00 $185.25 146974 Passenger Bridgestone TURANZA SERENITY PLUS 215/50R17 XL $215.47 20% $0.00 $172.39 146991 Passenger Bridgestone TURANZA SERENITY PLUS 235/50R17 $236.20 20% $0.00 $188.97 147042 Passenger Bridgestone TURANZA SERENITY PLUS 245/50R17 $248.01 20% $0.00 $198.41 147059 Passenger Bridgestone TURANZA SERENITY PLUS 235/55R17 $229.34 20% $0.00 $183.48 147093 Passenger Bridgestone TURANZA SERENITY PLUS 245/50R18 $299.55 20% $0.00 $239.65 147110 Passenger Bridgestone TURANZA SERENITY PLUS 205/60R16 $171.63 20% $0.00 $137.31 147127 Passenger Bridgestone TURANZA SERENITY PLUS 215/60R16 $187.99 20% $0.00 $150.40 148028 Passenger Bridgestone TURANZA SERENITY PLUS 245/40R19 $401.39 20% $0.00 $321.13 148045 Passenger Bridgestone TURANZA SERENITY PLUS 205/50R17 XL $217.25 20% $0.00 $173.81 004943 Passenger Bridgestone TURANZA T001 225/40R18 XL $306.58 20% $0.00 $245.27 005321 Passenger Bridgestone TURANZA T001 I RFT 225/55R17 $276.67 20% $0.00 $221.34 005323 Passenger Bridgestone TURANZA T001 RFT 225/50R18 $307.34 20% $0.00 $245.88 005324 Passenger Bridgestone TURANZA T001 RFT 225/45R17 $306.57 20% $0.00 $245.26 006376 Passenger Bridgestone TURANZA T005 225/40R18 XL $330.20 20% $0.00 $264.16 006379 Passenger Bridgestone TURANZA T005 225/45R17 $328.20 20% $0.00 $262.56 005966 Passenger Bridgestone TURANZA T005 RFT 245/45RF20 $384.08 20% $0.00 $307.27 005969 Passenger Bridgestone TURANZA T005 RFT 275/40RF20 $428.79 20% $0.00 $343.04 007186 Passenger Bridgestone TURANZA T005 RFT 245/50RF19 $346.64 20% $0.00 $277.31 003663 Passenger Bridgestone TURANZA T005A 235/45R18 $377.67 20% $0.00 $302.15 004435 Passenger Bridgestone TURANZA T100 215/55R17 $182.83 20% $0.00 $146.27 004436 Passenger Bridgestone TURANZA T100 235/40R19 $260.28 20% $0.00 $208.22 113450 Passenger Firestone WINTERFORCE P195/75R14 $106.78 20% $0.00 $85.42 113484 Passenger Firestone WINTERFORCE P205/75R15 $115.27 NET $0.00 $61.45 Discontinued w 113739 Passenger Firestone WINTERFORCE 205/70R15 $115.90 NET $0.00 $66.36 Discontinued w 113756 Passenger Firestone WINTERFORCE 215/70R15 $121.47 NET $0.00 $73.61 Discontinued w 113960 Passenger Firestone WINTERFORCE 175/65R14 $123.49 NET $0.00 $67.39 Discontinued w 114028 Passenger Firestone WINTERFORCE 195/65R15 $142.62 NET $0.00 $76.63 Discontinued w 114045 Passenger Firestone WINTERFORCE 215/65R15 $149.22 NET $0.00 $68.76 Discontinued w 114079 Passenger Firestone WINTERFORCE P215/65R17 $185.50 NET $0.00 $87.13 Discontinued w 114130 Passenger Firestone WINTERFORCE 185/60R15 $131.88 NET $0.00 $64.72 Discontinued w 114147 Passenger Firestone WINTERFORCE 195/60R15 $135.29 NET $0.00 $73.89 Discontinued w 114164 Passenger Firestone WINTERFORCE 205/60R15 $141.58 NET $0.00 $84.49 Discontinued w 114181 Passenger Firestone WINTERFORCE 215/60R15 $152.31 NET $0.00 $73.99 Discontinued w 114198 Passenger Firestone WINTERFORCE 205/60R16 $151.15 NET $0.00 $75.29 Discontinued w 114215 Passenger Firestone WINTERFORCE 215/60R16 $159.02 NET $0.00 $96.36 Discontinued w 114232 Passenger Firestone WINTERFORCE 225/60R16 $174.84 NET $0.00 $85.17 Discontinued w 114249 Passenger Firestone WINTERFORCE 225/60R17 $192.33 NET $0.00 $90.83 Discontinued w 114283 Passenger Firestone WINTERFORCE 205/55R16 $178.78 NET $0.00 $85.44 Discontinued w 114317 Passenger Firestone WINTERFORCE 215/55R17 $192.35 NET $0.00 $91.50 Discontinued w 114334 Passenger Firestone WINTERFORCE 225/55R17 $198.31 NET $0.00 $91.37 Discontinued w 122511 Passenger Firestone WINTERFORCE P225/50R17 $246.92 NET $0.00 $115.59 Discontinued w 123650 Passenger Firestone WINTERFORCE P225/50R16 $196.37 NET $0.00 $93.23 Discontinued w 003844 Passenger Firestone WINTERFORCE 2 205/65R16 $152.04 20% $0.00 $121.63 003848 Passenger Firestone WINTERFORCE 2 225/65R16 $164.53 20% $0.00 $131.62 003849 Passenger Firestone WINTERFORCE 2 175/65R15 $128.42 20% $0.00 $102.74 003852 Passenger Firestone WINTERFORCE 2 215/50R17 XL $200.05 20% $0.00 $160.04 148674 Passenger Firestone WINTERFORCE 2 185/60R14 $125.39 20% $0.00 $100.31 148691 Passenger Firestone WINTERFORCE 2 185/65R14 $128.64 20% $0.00 $102.91 148827 Passenger Firestone WINTERFORCE 2 185/60R15 $130.62 20% $0.00 $104.49 148844 Passenger Firestone WINTERFORCE 2 185/65R15 $136.52 20% $0.00 $109.22 148878 Passenger Firestone WINTERFORCE 2 195/60R15 $134.01 20% $0.00 $107.20 148895 Passenger Firestone WINTERFORCE 2 195/65R15 $141.26 20% $0.00 $113.01 148929 Passenger Firestone WINTERFORCE 2 205/65R15 $144.80 20% $0.00 $115.83 148963 Passenger Firestone WINTERFORCE 2 205/70R15 $114.79 20% $0.00 $91.83 148980 Passenger Firestone WINTERFORCE 2 P205/75R15 $114.17 20% $0.00 $91.34 149048 Passenger Firestone WINTERFORCE 2 215/70R15 $120.32 20% $0.00 $96.25 149065 Passenger Firestone WINTERFORCE 2 205/50R16 $185.92 20% $0.00 $148.74 149082 Passenger Firestone WINTERFORCE 2 205/55R16 $177.07 20% $0.00 $141.65 149099 Passenger Firestone WINTERFORCE 2 205/60R16 $149.71 20% $0.00 $119.76 149116 Passenger Firestone WINTERFORCE 2 215/55R16 $182.59 20% $0.00 $146.07 149133 Passenger Firestone WINTERFORCE 2 215/60R16 $157.50 20% $0.00 $126.00 149184 Passenger Firestone WINTERFORCE 2 225/60R16 $173.18 20% $0.00 $138.54 149201 Passenger Firestone WINTERFORCE 2 235/60R16 $180.11 20% $0.00 $144.08 149235 Passenger Firestone WINTERFORCE 2 215/55R17 $190.52 20% $0.00 $152.41 Page 19 of 5698 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 149252 Passenger Firestone WINTERFORCE 2 215/65R17 $171.93 20% $0.00 $137.54 149269 Passenger Firestone WINTERFORCE 2 225/50R17 $180.98 20% $0.00 $144.78 149286 Passenger Firestone WINTERFORCE 2 225/55R17 $196.42 20% $0.00 $157.13 149320 Passenger Firestone WINTERFORCE 2 235/55R17 $204.27 20% $0.00 $163.41 149337 Passenger Firestone WINTERFORCE 2 225/60R18 $209.57 20% $0.00 $167.65 003454 Passenger Firestone WINTERFORCE 2 UV P265/75R16 $187.46 20% $0.00 $149.97 003853 Passenger Firestone WINTERFORCE 2 UV 235/55R18 $228.84 20% $0.00 $183.07 003854 Passenger Firestone WINTERFORCE 2 UV P275/65R18 $239.94 20% $0.00 $191.95 003855 Passenger Firestone WINTERFORCE 2 UV 215/60R17 $180.99 20% $0.00 $144.79 003856 Passenger Firestone WINTERFORCE 2 UV 235/60R17 $198.12 20% $0.00 $158.49 003857 Passenger Firestone WINTERFORCE 2 UV 265/60R18 $242.27 20% $0.00 $193.81 006429 Passenger Firestone WINTERFORCE 2 UV 225/60R17 $190.49 20% $0.00 $152.39 148215 Passenger Firestone WINTERFORCE 2 UV 215/65R16 $183.20 20% $0.00 $146.56 148232 Passenger Firestone WINTERFORCE 2 UV 215/70R16 $142.14 20% $0.00 $113.71 148249 Passenger Firestone WINTERFORCE 2 UV 225/65R17 $180.98 20% $0.00 $144.78 148266 Passenger Firestone WINTERFORCE 2 UV 225/70R16 $156.29 20% $0.00 $125.03 148300 Passenger Firestone WINTERFORCE 2 UV 235/65R17 $184.35 20% $0.00 $147.48 148317 Passenger Firestone WINTERFORCE 2 UV 265/70R16 $193.90 20% $0.00 $155.12 148351 Passenger Firestone WINTERFORCE 2 UV 265/70R17 $209.27 20% $0.00 $167.42 148368 Passenger Firestone WINTERFORCE 2 UV P215/75R15 $139.38 20% $0.00 $111.50 148419 Passenger Firestone WINTERFORCE 2 UV P225/75R15 $146.08 20% $0.00 $116.86 148436 Passenger Firestone WINTERFORCE 2 UV P225/75R16 $169.37 20% $0.00 $135.49 148453 Passenger Firestone WINTERFORCE 2 UV P235/70R16 $176.39 NET $0.00 $98.33 148470 Passenger Firestone WINTERFORCE 2 UV P235/75R15 XL $153.09 20% $0.00 $122.47 148487 Passenger Firestone WINTERFORCE 2 UV P245/65R17 $239.42 20% $0.00 $191.53 148521 Passenger Firestone WINTERFORCE 2 UV P245/70R16 $181.12 20% $0.00 $144.89 148538 Passenger Firestone WINTERFORCE 2 UV P245/70R17 $198.67 20% $0.00 $158.93 148572 Passenger Firestone WINTERFORCE 2 UV P245/75R16 $173.41 20% $0.00 $138.73 148589 Passenger Firestone WINTERFORCE 2 UV P255/70R16 $187.31 20% $0.00 $149.84 148606 Passenger Firestone WINTERFORCE 2 UV P265/75R15 $174.21 20% $0.00 $139.36 000787 Passenger Firestone WINTERFORCE UV P245/70R16 $182.87 NET $0.00 $103.44 Discontinued w 113501 Passenger Firestone WINTERFORCE UV P215/75R15 $140.71 NET $0.00 $70.72 Discontinued w 113518 Passenger Firestone WINTERFORCE UV P225/75R15 $147.48 NET $0.00 $76.27 Discontinued w 113535 Passenger Firestone WINTERFORCE UV P235/75R15 $154.56 NET $0.00 $93.66 Discontinued w 113552 Passenger Firestone WINTERFORCE UV P235/75R15 XL $167.66 NET $0.00 $86.95 Discontinued w 113569 Passenger Firestone WINTERFORCE UV P225/75R16 XL $170.99 NET $0.00 $84.26 Discontinued w 113620 Passenger Firestone WINTERFORCE UV P265/75R16 $189.27 NET $0.00 $95.88 Discontinued w 113773 Passenger Firestone WINTERFORCE UV 225/70R15 $144.42 NET $0.00 $74.77 Discontinued w 113790 Passenger Firestone WINTERFORCE UV P235/70R15 $160.31 NET $0.00 $79.63 Discontinued w 113841 Passenger Firestone WINTERFORCE UV P225/70R16 $168.33 NET $0.00 $94.95 Discontinued w 113909 Passenger Firestone WINTERFORCE UV P255/70R16 $189.10 NET $0.00 $93.71 Discontinued w 113926 Passenger Firestone WINTERFORCE UV P265/70R16 $195.77 NET $0.00 $97.07 Discontinued w 114062 Passenger Firestone WINTERFORCE UV 215/65R16 $184.96 NET $0.00 $85.91 Discontinued w 114096 Passenger Firestone WINTERFORCE UV 245/65R17 $241.72 NET $0.00 $114.03 Discontinued w 122477 Passenger Firestone WINTERFORCE UV P235/65R17 $230.84 NET $0.00 $109.10 Discontinued w 124279 Passenger Firestone WINTERFORCE UV P265/75R15 $175.88 NET $0.00 $101.41 Discontinued w 023189 Police Pursuit Firestone FIREHAWK GT V PURSUIT P265/60R17 $284.80 NET $0.00 $124.40 000177 Police Pursuit Firestone FIREHAWK GT Z PURSUIT 245/55R18 $301.19 NET $0.00 $130.84 003874 Police Pursuit Firestone FIREHAWK GT Z PURSUIT P235/55R17 $243.49 NET $0.00 $111.70 003875 Police Pursuit Firestone FIREHAWK GT Z PURSUIT P225/60R18 $278.55 NET $0.00 $117.94 023308 Police Pursuit Firestone FIREHAWK GT Z PURSUIT P235/50R18 XL $315.90 NET $0.00 $139.98 077325 Police Pursuit Firestone FIREHAWK GT Z PURSUIT P235/55R17 $243.49 NET $0.00 $111.70 Discontinued w 067911 Police Pursuit Firestone FIREHAWK PV41 P225/60R16 $159.31 NET $0.00 $97.85 000252 Police Pursuit Firestone FIREHAWK PVS 245/55R18 $352.49 NET $0.00 $146.07 023325 Police Pursuit Firestone FIREHAWK PVS P235/50R18 XL $369.71 NET $0.00 $153.20 077359 Police Pursuit Firestone FIREHAWK PVS P235/55R17 $267.84 NET $0.00 $117.95 077376 Police Pursuit Firestone FIREHAWK PVS P225/60R18 $314.59 NET $0.00 $129.10 098388 Police Pursuit Firestone FIREHAWK PVS P225/60R16 $175.27 NET $0.00 $100.33 149558 Police Pursuit Firestone FIREHAWK PVS P265/60R17 $274.76 NET $0.00 $121.79 000900 Off The Road Firestone ALL TRACTION UTILITY 16.9-28 8 $801.00 37% $0.00 $504.63 306371 Off The Road Firestone ALL TRACTION UTILITY 14.9-28 8 $676.00 37% $0.00 $425.88 316083 Off The Road Firestone ALL TRACTION UTILITY 18.4-24 8 $983.00 37% $0.00 $619.29 321370 Off The Road Firestone ALL TRACTION UTILITY 21L-24 12 $1,199.00 37% $0.00 $755.37 325880 Off The Road Firestone ALL TRACTION UTILITY 17.5L-24 10 $767.00 37% $0.00 $483.21 327727 Off The Road Firestone ALL TRACTION UTILITY 21L-24 16 $1,407.00 37% $0.00 $886.41 342548 Off The Road Firestone ALL TRACTION UTILITY 10.0/10.5-20 10 $625.00 37% $0.00 $393.75 351741 Off The Road Firestone ALL TRACTION UTILITY 10.5/80-18 10 $329.00 37% $0.00 $207.27 355224 Off The Road Firestone ALL TRACTION UTILITY 18.4-24 12 $1,262.00 37% $0.00 $795.06 355410 Off The Road Firestone ALL TRACTION UTILITY 18.4-28 12 $1,031.00 37% $0.00 $649.53 356093 Off The Road Firestone ALL TRACTION UTILITY 21L-28 14 $1,469.00 37% $0.00 $925.47 358398 Off The Road Firestone ALL TRACTION UTILITY 12.5-20 10 $803.00 37% $0.00 $505.89 359343 Off The Road Firestone ALL TRACTION UTILITY 19.5L-24 10 $855.00 37% $0.00 $538.65 363990 Off The Road Firestone ALL TRACTION UTILITY 16.9-24 12 $788.00 37% $0.00 $496.44 372762 Off The Road Firestone ALL TRACTION UTILITY 21L-24 18 $1,560.00 37% $0.00 $982.80 379307 Off The Road Firestone ALL TRACTION UTILITY 16.9-28 12 $890.00 37% $0.00 $560.70 380259 Off The Road Firestone ALL TRACTION UTILITY 19.5L-24 12 $941.00 37% $0.00 $592.83 005515 Off The Road Firestone COMPACTADOR C-1 13.00-24 8 $1,480.00 37% $0.00 $932.40 261173 Off The Road Bridgestone D-LUG D2A 17.5-25 16 $2,874.90 37% $0.00 $1,811.19 275530 Off The Road Bridgestone D-LUG D2A 26.5-25 20 $6,785.10 37% $0.00 $4,274.61 423408 Off The Road Bridgestone D-LUG D2A 29.5-25 28 $9,504.60 37% $0.00 $5,987.90 419400 Off The Road Bridgestone D-LUG D2V 45/65-45 58 $26,960.85 37% $0.00 $16,985.34 006395 Off The Road Bridgestone D-LUG LD 35/65-33 42 $15,015.00 37% $0.00 $9,459.45 422150 Off The Road Bridgestone D-LUG LD 35/65-33 42 $15,765.75 37% $0.00 $9,932.42 362158 Off The Road Firestone DURAFORCE 355/70D17.5 10 $466.00 37% $0.00 $293.58 001277 Off The Road Firestone DURAFORCE AP 18.00-25 16 $2,331.00 37% $0.00 $1,468.53 003771 Off The Road Firestone DURAFORCE AP 21.00-25 16 $3,003.00 37% $0.00 $1,891.89 360414 Off The Road Firestone DURAFORCE DEEP TREAD 305/70D16.5NHS 10 $369.00 37% $0.00 $232.47 360449 Off The Road Firestone DURAFORCE DEEP TREAD 215/70D15NHS 8 $221.00 37% $0.00 $139.23 360457 Off The Road Firestone DURAFORCE DEEP TREAD 260/65D15NHS 8 $250.00 37% $0.00 $157.50 360465 Off The Road Firestone DURAFORCE DEEP TREAD 390/60D15NHS 8 $487.00 37% $0.00 $306.81 360473 Off The Road Firestone DURAFORCE DEEP TREAD 265/70D16.5NHS 8 $266.00 37% $0.00 $167.58 360481 Off The Road Firestone DURAFORCE DEEP TREAD 330/55D16.5NHS 10 $378.00 37% $0.00 $238.14 373170 Off The Road Firestone DURAFORCE DEEP TREAD 305/70D16.5 12 $436.00 37% $0.00 $274.68 362123 Off The Road Firestone DURAFORCE HD 265/70D16.5 8 $224.00 37% $0.00 $141.12 362131 Off The Road Firestone DURAFORCE HD 305/70D16.5 10 $283.00 37% $0.00 $178.29 429770 Off The Road Firestone DURAFORCE MH 370/75-28 14 $1,571.85 37% $0.00 $990.27 431453 Off The Road Firestone DURAFORCE MH 400/75-28 16 $1,672.65 37% $0.00 $1,053.77 361674 Off The Road Firestone DURAFORCE NON-DIRECTIONAL 355/70D17.5NHS 14 $673.00 37% $0.00 $423.99 361690 Off The Road Firestone DURAFORCE NON-DIRECTIONAL 385/65D19.5 16 $999.00 37% $0.00 $629.37 361712 Off The Road Firestone DURAFORCE NON-DIRECTIONAL 445/65D19.5NHS 16 $1,260.00 37% $0.00 $793.80 365707 Off The Road Firestone DURAFORCE SUPER DEEP TREA 265/70D16.5NHS 10 $408.00 37% $0.00 $257.04 365724 Off The Road Firestone DURAFORCE SUPER DEEP TREA 305/70D16.5NHS 12 $472.00 37% $0.00 $297.36 365741 Off The Road Firestone DURAFORCE SUPER DEEP TREA 355/70D17.5NHS 14 $599.00 37% $0.00 $377.37 Page 20 of 5699 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 003997 Off The Road Firestone DURAFORCE UTILITY 405/70R18 $1,177.00 37% $0.00 $741.51 004502 Off The Road Firestone DURAFORCE UTILITY 340/80R18 $582.00 37% $0.00 $366.66 000989 Off The Road Firestone DURALOAD DT 35/65-33 42 $12,916.05 37% $0.00 $8,137.11 000990 Off The Road Firestone DURALOAD DT 35/65-33 42 $13,561.80 37% $0.00 $8,543.93 431691 Off The Road Firestone DURALOAD DT 45/65-45 58 $22,129.80 37% $0.00 $13,941.77 431708 Off The Road Firestone DURALOAD DT 45/65-45 58 $23,900.10 37% $0.00 $15,057.06 000468 Off The Road Firestone DURALOAD PT 45/65-45 58 $25,723.95 37% $0.00 $16,206.09 000469 Off The Road Firestone DURALOAD PT 45/65-45 58 $26,899.95 37% $0.00 $16,946.97 000992 Off The Road Firestone DURALOAD PT 35/65-33 42 $15,886.50 37% $0.00 $10,008.50 000991 Off The Road Firestone DURALOAD SDT 35/65-33 42 $14,140.35 37% $0.00 $8,908.42 431606 Off The Road Firestone DURALOAD SDT 45/65-45 58 $25,746.00 37% $0.00 $16,219.98 431657 Off The Road Firestone DURALOAD SDT 35/65-33 42 $14,847.00 37% $0.00 $9,353.61 431674 Off The Road Firestone DURALOAD SDT 45/65-45 58 $24,541.65 37% $0.00 $15,461.24 422894 Off The Road Bridgestone E-LUG S2 INDUSTRIAL E4 18.00-25 40 $4,827.90 37% $0.00 $3,041.58 423645 Off The Road Bridgestone E-LUG S2 INDUSTRIAL E4 18.00-33 36 $6,466.95 37% $0.00 $4,074.18 153524 Off The Road Bridgestone FAST GRIP 11.00-20 16 $931.35 37% $0.00 $586.75 290416 Off The Road Bridgestone FAST GRIP 15.5/60-18 8 $771.75 37% $0.00 $486.20 211223 Off The Road Bridgestone FAST GRIP D2A 10.00-20 16 $903.00 37% $0.00 $568.89 298433 Off The Road Bridgestone FAST GRIP D2A 12.5/70-16 8 $565.95 37% $0.00 $356.55 280255 Off The Road Firestone HALF TREAD LDR DZR L5/L5S 65/45-45 50 $24,934.35 37% $0.00 $15,708.64 416991 Off The Road Firestone HALF TREAD LDR DZR L5/L5S 29.5-25 28 $7,809.90 37% $0.00 $4,920.24 430246 Off The Road Firestone HALF TREAD LDR DZR L5/L5S 65/35-33 42 $15,122.10 37% $0.00 $9,526.92 378355 Off The Road Regency INDUSTRIAL FRONT 11L-16 12 $181.00 37% $0.00 $114.03 378372 Off The Road Regency INDUSTRIAL FRONT 11L-16 10 $158.00 37% $0.00 $99.54 314625 Off The Road Firestone INDUSTRIAL SPECIAL 11L-16 10 $225.00 37% $0.00 $141.75 321567 Off The Road Firestone INDUSTRIAL SPECIAL 14.5/75-16.1 10 $530.00 37% $0.00 $333.90 326089 Off The Road Firestone INDUSTRIAL SPECIAL 11L-16 12 $242.00 37% $0.00 $152.46 005524 Off The Road Firestone PLAIN TREAD IDU 18.00-25 40 $5,050.34 37% $0.00 $3,181.71 417335 Off The Road Firestone PLAIN TREAD LDR DZR 26.5-25 26 $7,638.75 37% $0.00 $4,812.41 417408 Off The Road Firestone PLAIN TREAD LDR DZR 29.5-25 34 $8,633.10 37% $0.00 $5,438.85 417602 Off The Road Firestone PLAIN TREAD LDR DZR 65/35-33 36 $14,561.40 37% $0.00 $9,173.68 423173 Off The Road Firestone PLAIN TREAD LDR DZR 45/65-39 46 $20,749.05 37% $0.00 $13,071.90 427917 Off The Road Firestone PLAIN TREAD LDR DZR 65/35-33 42 $15,878.10 37% $0.00 $10,003.20 003565 Off The Road Firestone PLAIN TREAD LDR DZR IDU 33.25-35 50 $13,600.00 37% $0.00 $8,568.00 431776 Off The Road Firestone PLAIN TREAD LDR DZR UMS CRC 29.5-29 34 $10,600.00 37% $0.00 $6,678.00 416568 Off The Road Firestone PLAIN TREAD LDR DZR UMS L5S 26.5-25 32 $8,718.15 37% $0.00 $5,492.43 416819 Off The Road Firestone PLAIN TREAD LDR DZR UMS L5S 18.00-25 32 $6,350.00 37% $0.00 $4,000.50 416983 Off The Road Firestone PLAIN TREAD LDR DZR UMS L5S 21.00-25 32 $7,586.25 37% $0.00 $4,779.34 430484 Off The Road Firestone PLAIN TREAD LDR DZR UMS L5S 29.5-25 34 $9,226.35 37% $0.00 $5,812.60 351989 Off The Road Firestone RADIAL ALLTRACTIONUTILITY 17.5LR24 2*$900.00 37% $0.00 $567.00 000402 Off The Road Firestone RADIAL DURAFORCE RT 540/70R24 $1,755.00 37% $0.00 $1,105.65 371657 Off The Road Firestone RADIAL DURAFORCE RT 500/70R24 $988.00 37% $0.00 $622.44 375975 Off The Road Firestone RADIAL DURAFORCE RT 340/80R18 $582.00 37% $0.00 $366.66 376842 Off The Road Firestone RADIAL DURAFORCE RT 500/70R24 $1,072.00 37% $0.00 $675.36 380497 Off The Road Firestone RADIAL DURAFORCE RT 320/80R18 $555.00 37% $0.00 $349.65 425605 Off The Road Bridgestone R-LUG D2A 17.5-25 16 $1,436.40 37% $0.00 $904.93 285366 Off The Road Bridgestone R-LUG E1A 12.00-20 18 $1,437.45 37% $0.00 $905.59 296295 Off The Road Bridgestone R-LUG E2A 14.00-24 28 $2,074.80 37% $0.00 $1,307.12 424789 Off The Road Bridgestone R-LUG IDU 21.00-25 40 $5,876.85 37% $0.00 $3,702.42 003551 Off The Road Bridgestone R-LUG S D2A 26.5-25 26 $5,198.55 37% $0.00 $3,275.09 275328 Off The Road Bridgestone R-LUG S D2A 29.5-25 28 $7,704.90 37% $0.00 $4,854.09 276057 Off The Road Bridgestone R-LUG S E2A 24.00-35 42 $9,049.95 37% $0.00 $5,701.47 191112 Off The Road Bridgestone ROAD ROLLER 14/70-20 12 $2,304.75 37% $0.00 $1,451.99 226751 Off The Road Bridgestone ROAD ROLLER 95/65-15 6 $665.70 37% $0.00 $419.39 289450 Off The Road Bridgestone ROAD ROLLER 9.00-20 10 $725.55 37% $0.00 $457.10 299944 Off The Road Bridgestone ROAD ROLLER 7.50-16 6 $528.15 37% $0.00 $332.73 415847 Off The Road Firestone SAND & HIGHWAY 27.25-21 16 $2,660.00 37% $0.00 $1,675.80 416908 Off The Road Firestone SAND CHAMPION 29.5-25 28 $4,973.85 37% $0.00 $3,133.53 378389 Off The Road Regency SKID STEER 10-16.5 8 $175.00 37% $0.00 $110.25 378712 Off The Road Regency SKID STEER 12-16.5 10 $210.00 37% $0.00 $132.30 261289 Off The Road Bridgestone SMOOTH TREAD-MS D2A 17.5-25 20 $3,262.00 37% $0.00 $2,055.06 263303 Off The Road Bridgestone SMOOTH TREAD-MS D2A 14.00-24 20 $2,625.00 37% $0.00 $1,653.75 275573 Off The Road Bridgestone SMOOTH TREAD-MS D2A 26.5-25 32 $8,850.45 37% $0.00 $5,575.78 295256 Off The Road Bridgestone SMOOTH TREAD-MS D2A 12.00-24 20 $2,114.70 37% $0.00 $1,332.26 419095 Off The Road Bridgestone SMOOTH TREAD-MS D2A 29.5-29 34 $12,250.00 37% $0.00 $7,717.50 420972 Off The Road Bridgestone SMOOTH TREAD-MS D2A 18.00-25 32 $6,585.60 37% $0.00 $4,148.93 421863 Off The Road Bridgestone SMOOTH TREAD-MS D2A 26.5-25 36 $9,103.50 37% $0.00 $5,735.21 422657 Off The Road Bridgestone SMOOTH TREAD-MS D2V 45/65-45 58 $27,231.75 37% $0.00 $17,156.00 424874 Off The Road Bridgestone SMOOTH TREAD-MS D2V 35/65-33 42 $17,517.15 37% $0.00 $11,035.80 422231 Off The Road Bridgestone SMOOTH TREAD-MS IDU 18.00-25 40 $6,619.20 37% $0.00 $4,170.10 280159 Off The Road Firestone SUPER DEEP TREAD L5 65/40-39 36 $17,479.35 37% $0.00 $11,011.99 403903 Off The Road Firestone SUPER DEEP TREAD L5 20.5-25 16 $3,010.35 37% $0.00 $1,896.52 403911 Off The Road Firestone SUPER DEEP TREAD L5 23.5-25 16 $4,252.50 37% $0.00 $2,679.08 403962 Off The Road Firestone SUPER DEEP TREAD L5 29.5-29 28 $8,660.40 37% $0.00 $5,456.05 403970 Off The Road Firestone SUPER DEEP TREAD L5 23.5-25 20 $4,336.50 37% $0.00 $2,732.00 403989 Off The Road Firestone SUPER DEEP TREAD L5 26.5-25 20 $6,018.60 37% $0.00 $3,791.72 413984 Off The Road Firestone SUPER DEEP TREAD L5 29.5-25 22 $6,837.60 37% $0.00 $4,307.69 416428 Off The Road Firestone SUPER DEEP TREAD L5 26.5-25 26 $6,122.55 37% $0.00 $3,857.21 416436 Off The Road Firestone SUPER DEEP TREAD L5 29.5-25 28 $6,858.60 37% $0.00 $4,320.92 416649 Off The Road Firestone SUPER DEEP TREAD L5 65/35-33 30 $12,961.20 37% $0.00 $8,165.56 416789 Off The Road Firestone SUPER DEEP TREAD L5 41.25/70-39 42 $19,933.20 37% $0.00 $12,557.92 417033 Off The Road Firestone SUPER DEEP TREAD L5 41.25/70-39 42 $18,812.85 37% $0.00 $11,852.10 417610 Off The Road Firestone SUPER DEEP TREAD L5 20.5-25 20 $3,329.55 37% $0.00 $2,097.62 427832 Off The Road Firestone SUPER DEEP TREAD L5 65/35-33 42 $14,401.80 37% $0.00 $9,073.13 404810 Off The Road Firestone SUPER GROUND GRIP E2 29.5-25 22 $4,758.60 37% $0.00 $2,997.92 404969 Off The Road Firestone SUPER GROUND GRIP E2/L2 23.5-25 20 $2,665.95 37% $0.00 $1,679.55 426166 Off The Road Firestone SUPER GROUND GRIP G2 16.00-24 16 $1,861.65 37% $0.00 $1,172.84 405175 Off The Road Firestone SUPER GROUND GRIP LD 20.5-25 12 $1,612.80 37% $0.00 $1,016.06 408492 Off The Road Firestone SUPER GROUND GRIP LD 20.5-25 16 $1,669.50 37% $0.00 $1,051.79 425129 Off The Road Firestone SUPER GROUND GRIP LD 17.5-25 12 $934.50 37% $0.00 $588.74 425180 Off The Road Firestone SUPER GROUND GRIP LD 17.5-25 16 $1,061.55 37% $0.00 $668.78 425248 Off The Road Firestone SUPER GROUND GRIP LD 15.5-25 12 $929.67 37% $0.00 $585.69 429243 Off The Road Firestone SUPER GROUND GRIP LD 17.5-25 20 $1,496.25 37% $0.00 $942.64 429209 Off The Road Firestone SUPER GROUND GRIP MH 13.00-24 12 $669.90 37% $0.00 $422.04 425163 Off The Road Firestone SUPER GROUND GRIP RB TG 13.00-24 16 $729.75 37% $0.00 $459.74 425214 Off The Road Firestone SUPER GROUND GRIP RB TG 14.00-24 12 $830.55 37% $0.00 $523.25 425384 Off The Road Firestone SUPER GROUND GRIP RB TG 14.00-24 16 $863.10 37% $0.00 $543.75 403172 Off The Road Firestone SUPER ROCK GRIP DT 18.00-25 32 $3,800.00 37% $0.00 $2,394.00 411663 Off The Road Firestone SUPER ROCK GRIP DT 27.00-49 48 $12,801.60 37% $0.00 $8,065.01 413380 Off The Road Firestone SUPER ROCK GRIP DT 33.25-35 38 $11,977.35 37% $0.00 $7,545.73 413623 Off The Road Firestone SUPER ROCK GRIP DT 37.25-35 36 $13,724.00 37% $0.00 $8,646.12 413925 Off The Road Firestone SUPER ROCK GRIP DT 18.00-33 32 $4,900.00 37% $0.00 $3,087.00 416711 Off The Road Firestone SUPER ROCK GRIP DT 30.00-51 52 $23,806.39 37% $0.00 $14,998.03 Page 21 of 56100 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 414131 Off The Road Firestone SUPER ROCK GRIP DT CRC 21.00-35 36 $5,875.00 37% $0.00 $3,701.25 414972 Off The Road Firestone SUPER ROCK GRIP DT CRC 18.00-33 32 $4,900.00 37% $0.00 $3,087.00 423149 Off The Road Firestone SUPER ROCK GRIP DT E4 16.00-25 28 $3,042.90 37% $0.00 $1,917.03 425656 Off The Road Firestone SUPER ROCK GRIP DT G4 14.00-24 12 $1,297.80 37% $0.00 $817.61 416185 Off The Road Firestone SUPER ROCK GRIP DT LD 65/35-33 30 $11,901.75 37% $0.00 $7,498.10 416401 Off The Road Firestone SUPER ROCK GRIP DT LD 26.5-25 26 $5,171.25 37% $0.00 $3,257.89 416924 Off The Road Firestone SUPER ROCK GRIP DT LD 29.5-25 28 $6,743.10 37% $0.00 $4,248.15 416215 Off The Road Firestone SUPER ROCK GRIP DT LD IDU 30-33 46 $11,797.80 37% $0.00 $7,432.61 421294 Off The Road Firestone SUPER ROCK GRIP DT LD IDU 65/35-33 42 $12,528.60 37% $0.00 $7,893.02 421308 Off The Road Firestone SUPER ROCK GRIP DT RC IDU 18.00-33 44 $6,321.00 37% $0.00 $3,982.23 426064 Off The Road Firestone SUPER ROCK GRIP DT UF CPD IDU18.00-25 40 $4,600.00 37% $0.00 $2,898.00 280138 Off The Road Firestone SUPER ROCK GRIP E3 33.25-29 32 $7,867.65 37% $0.00 $4,956.62 401501 Off The Road Firestone SUPER ROCK GRIP E3 37.5-33 42 $14,285.71 37% $0.00 $9,000.00 401560 Off The Road Firestone SUPER ROCK GRIP E3 18.00-49 32 $7,486.50 37% $0.00 $4,716.50 401625 Off The Road Firestone SUPER ROCK GRIP E3 29.5-29 34 $6,389.25 37% $0.00 $4,025.23 401668 Off The Road Firestone SUPER ROCK GRIP E3 29.5-35 34 $9,375.45 37% $0.00 $5,906.53 401889 Off The Road Firestone SUPER ROCK GRIP E3 29.5-29 28 $6,233.85 37% $0.00 $3,927.33 410241 Off The Road Firestone SUPER ROCK GRIP E3 33.25-35 38 $10,989.30 37% $0.00 $6,923.26 413127 Off The Road Firestone SUPER ROCK GRIP E3 30-56.5 48 $18,771.75 37% $0.00 $11,826.20 413461 Off The Road Firestone SUPER ROCK GRIP E3 37.25-35 36 $12,416.25 37% $0.00 $7,822.24 413518 Off The Road Firestone SUPER ROCK GRIP E3 16.00-25 28 $2,790.90 37% $0.00 $1,758.27 480136 Off The Road Firestone SUPER ROCK GRIP E3/L3 IDU 26.5-25 44 $7,822.50 37% $0.00 $4,928.18 280004 Off The Road Firestone SUPER ROCK GRIP IDU 33.25-35 50 $15,479.10 37% $0.00 $9,751.83 411604 Off The Road Firestone SUPER ROCK GRIP IDU 21.00-35 40 $6,786.15 37% $0.00 $4,275.27 800560 Off The Road Firestone SUPER ROCK GRIP IDU 33.5-33 50 $13,004.25 37% $0.00 $8,192.68 416916 Off The Road Firestone SUPER ROCK GRIP LD 29.5-29 40 $7,751.10 37% $0.00 $4,883.19 425537 Off The Road Firestone SUPER ROCK GRIP LD 17.5-25 12 $1,043.70 37% $0.00 $657.53 425554 Off The Road Firestone SUPER ROCK GRIP LD 17.5-25 16 $1,247.40 37% $0.00 $785.86 425571 Off The Road Firestone SUPER ROCK GRIP LD 17.5-25 20 $1,757.70 37% $0.00 $1,107.35 400610 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 23.5-25 20 $2,504.25 37% $0.00 $1,577.68 400629 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 26.5-25 20 $4,004.70 37% $0.00 $2,522.96 401757 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 26.5-25 26 $4,572.75 37% $0.00 $2,880.83 408476 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 20.5-25 16 $1,811.25 37% $0.00 $1,141.09 414638 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 29.5-25 28 $5,350.00 37% $0.00 $3,370.50 414646 Off The Road Firestone SUPER ROCK GRIP LD E3/L3 20.5-25 20 $1,830.15 37% $0.00 $1,152.99 412546 Off The Road Firestone SUPER ROCK GRIP RC E3 37.5-39 52 $15,655.50 37% $0.00 $9,862.97 359599 Off The Road Firestone SUPER TRACTION DUPLEX 15-22.5NHS 16 $1,187.00 37% $0.00 $747.81 416177 Off The Road Firestone SUPER TRACTION DUPLEX 14-17.5NHS 10 $461.00 37% $0.00 $290.43 416517 Off The Road Firestone SUPER TRACTION DUPLEX 15-19.5NHS 12 $705.00 37% $0.00 $444.15 359912 Off The Road Firestone SUPER TRACTION LOADER 12.5/80-18 12 $403.00 37% $0.00 $253.89 005498 Off The Road Firestone VERSABUILT ALL PURPOSE 17.5R25 MS $1,625.40 37% $0.00 $1,024.00 005499 Off The Road Firestone VERSABUILT ALL PURPOSE 20.5R25 MS $2,083.20 37% $0.00 $1,312.42 005501 Off The Road Firestone VERSABUILT ALL PURPOSE 23.5R25 MS $2,916.90 37% $0.00 $1,837.65 005502 Off The Road Firestone VERSABUILT ALL PURPOSE 26.5R25 MS $4,250.40 37% $0.00 $2,677.75 005503 Off The Road Firestone VERSABUILT ALL PURPOSE 29.5R25 MS $5,499.90 37% $0.00 $3,464.94 005507 Off The Road Firestone VERSABUILT ALL TRACTION 17.5R25 1*$1,524.60 37% $0.00 $960.50 005508 Off The Road Firestone VERSABUILT ALL TRACTION 20.5R25 1*$1,916.25 37% $0.00 $1,207.24 005509 Off The Road Firestone VERSABUILT ALL TRACTION 23.5R25 1*$2,825.55 37% $0.00 $1,780.10 005504 Off The Road Firestone VERSABUILT DEEP TREAD 23.5R25 MS $4,166.40 37% $0.00 $2,624.83 005505 Off The Road Firestone VERSABUILT DEEP TREAD 26.5R25 MS $5,749.80 37% $0.00 $3,622.37 005506 Off The Road Firestone VERSABUILT DEEP TREAD 29.5R25 MS $7,166.25 37% $0.00 $4,514.74 003790 Off The Road Bridgestone V-LUG2 D2A 20.5-25 16 $2,300.55 37% $0.00 $1,449.35 003791 Off The Road Bridgestone V-LUG2 D2A 17.5-25 16 $1,436.40 37% $0.00 $904.93 005309 Off The Road Bridgestone V-LUG2 D2A 23.5-25 20 $2,875.00 37% $0.00 $1,811.25 003553 Off The Road Bridgestone V-LUG2 DE2 26.5-25 20 $4,150.40 37% $0.00 $2,614.75 190177 Off The Road Bridgestone V-STL CNTANR HNDLR IND VCH ID12.00R24 2*$2,062.42 37% $0.00 $1,299.32 293016 Off The Road Bridgestone V-STL CNTANR HNDLR IND VCH ID14.00R24 3*$3,274.78 37% $0.00 $2,063.11 422053 Off The Road Bridgestone V-STL CNTANR HNDLR-D 16.00R25 2*$3,992.90 37% $0.00 $2,515.53 431810 Off The Road Bridgestone V-STL CNTANR HNDLR-R IDU 16.00R25 2*$4,542.30 37% $0.00 $2,861.65 007273 Off The Road Bridgestone V-STL CNTANR HNDLR-S IDU 14.00R24 3*$3,260.72 37% $0.00 $2,054.25 188205 Off The Road Bridgestone V-STL CNTANR HNDLR-S IDU 14.00R24 3*$3,109.31 37% $0.00 $1,958.87 227397 Off The Road Bridgestone V-STL CNTANR HNDLR-S IDU 12.00R20 3*$2,180.30 37% $0.00 $1,373.59 423939 Off The Road Bridgestone V-STL CNTANR HNDLR-S IDU 18.00R25 3*$6,249.99 37% $0.00 $3,937.49 424064 Off The Road Bridgestone V-STL CNTANR HNDLR-S IDU 18.00R33 3*$7,800.00 37% $0.00 $4,914.00 419036 Off The Road Bridgestone V-STL D-LUG D&L D2A 45/65R45 1* $30,129.51 37% $0.00 $18,981.59 426047 Off The Road Bridgestone V-STL D-LUG D&L D2A 45/65R45 2* $30,876.83 37% $0.00 $19,452.40 152455 Off The Road Bridgestone V-STL D-LUG D2A 14.5R15 2*$1,861.26 37% $0.00 $1,172.59 157384 Off The Road Bridgestone V-STL D-LUG D2A 10.00R15 2*$1,594.13 37% $0.00 $1,004.30 157392 Off The Road Bridgestone V-STL D-LUG D2A 12.00R20 2*$2,200.00 37% $0.00 $1,386.00 420565 Off The Road Bridgestone V-STL D-LUG D2A 23.5R25 1*$7,840.88 37% $0.00 $4,939.75 420573 Off The Road Bridgestone V-STL D-LUG D2A 26.5R25 1*$9,945.30 37% $0.00 $6,265.54 420581 Off The Road Bridgestone V-STL D-LUG D2A 29.5R25 1* $13,593.37 37% $0.00 $8,563.82 421332 Off The Road Bridgestone V-STL D-LUG D2A 26.5R25 2* $10,243.66 37% $0.00 $6,453.51 421758 Off The Road Bridgestone V-STL D-LUG D2A 29.5R29 2* $14,762.48 37% $0.00 $9,300.36 421855 Off The Road Bridgestone V-STL D-LUG D2A 20.5R25 1*$7,028.67 37% $0.00 $4,428.06 422428 Off The Road Bridgestone V-STL D-LUG D2A 23.5R25 2*$8,050.69 37% $0.00 $5,071.93 423165 Off The Road Bridgestone V-STL D-LUG D2A 17.5R25 1*$3,974.51 37% $0.00 $2,503.94 423378 Off The Road Bridgestone V-STL D-LUG D2A 45/65R39 1* $25,336.95 37% $0.00 $15,962.28 423432 Off The Road Bridgestone V-STL D-LUG D2A 29.5R25 2* $13,891.87 37% $0.00 $8,751.88 424544 Off The Road Bridgestone V-STL D-LUG D2A 8.25R15 2*$1,263.19 37% $0.00 $795.81 425010 Off The Road Bridgestone V-STL D-LUG D2A 35/65R33 2* $15,402.94 37% $0.00 $9,703.85 429872 Off The Road Bridgestone V-STL D-LUG IDU 35/65R33 2* $16,173.09 37% $0.00 $10,189.05 422843 Off The Road Bridgestone V-STL D-LUG LAC D2A 45/65R45 2* $30,876.83 37% $0.00 $19,452.40 423386 Off The Road Bridgestone V-STL D-LUG LS D2A 45/65R39 1* $25,336.95 37% $0.00 $15,962.28 275867 Off The Road Bridgestone V-STL E-LUG S E1A 18.00R33 2*$7,267.68 37% $0.00 $4,578.64 276316 Off The Road Bridgestone V-STL E-LUG S E2A 18.00R33 2*$7,267.68 37% $0.00 $4,578.64 276324 Off The Road Bridgestone V-STL E-LUG S E2A 21.00R35 2* $11,355.75 37% $0.00 $7,154.12 419281 Off The Road Bridgestone V-STL E-LUG S E2A 18.00R25 2*$5,976.37 37% $0.00 $3,765.11 422177 Off The Road Bridgestone V-STL E-LUG S LS E2A 18.00R33 2*$7,267.68 37% $0.00 $4,578.64 418927 Off The Road Bridgestone V-STL F-TRACTN E3A 18.00R33 2*$5,893.09 37% $0.00 $3,712.65 420077 Off The Road Bridgestone V-STL F-TRACTN E3A 27.00R49 2* $13,616.09 37% $0.00 $8,578.14 418951 Off The Road Bridgestone V-STL G-TRACTN 24R21 1*$3,796.07 37% $0.00 $2,391.52 424976 Off The Road Bridgestone V-STL G-TRACTN 445/80R25 2*$2,766.48 37% $0.00 $1,742.88 005300 Off The Road Bridgestone V-STL H-SERV HIGH SPEED 525/80R25 2*$3,749.56 37% $0.00 $2,362.22 421790 Off The Road Bridgestone V-STL H-SERV HIGH SPEED 385/95R24 3*$2,309.00 37% $0.00 $1,454.67 430824 Off The Road Bridgestone V-STL H-SERV HIGH SPEED 385/95R25 3*$2,341.45 37% $0.00 $1,475.11 430841 Off The Road Bridgestone V-STL H-SERV HIGH SPEED 445/95R25 2*$3,718.20 37% $0.00 $2,342.47 419362 Off The Road Bridgestone V-STL JAMAL E7 21.00R25 $7,197.38 37% $0.00 $4,534.35 006536 Off The Road Bridgestone V-STL J-TRACTN 23.5R25 2*$4,253.54 37% $0.00 $2,679.73 004071 Off The Road Bridgestone V-STL J-TRACTN D2A 29.5R25 2*$8,034.46 37% $0.00 $5,061.71 431198 Off The Road Bridgestone V-STL J-TRACTN D2A 23.5R25 1*$3,977.76 37% $0.00 $2,505.99 431215 Off The Road Bridgestone V-STL J-TRACTN D2A 26.5R25 1*$5,336.12 37% $0.00 $3,361.76 431538 Off The Road Bridgestone V-STL J-TRACTN D2A 17.5R25 1*$2,158.67 37% $0.00 $1,359.96 Page 22 of 56101 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 431555 Off The Road Bridgestone V-STL J-TRACTN D2A 29.5R25 1*$7,090.31 37% $0.00 $4,466.90 003994 Off The Road Bridgestone V-STL J-TRACTN DG2 20.5R25 1*$3,066.05 37% $0.00 $1,931.61 263389 Off The Road Bridgestone V-STL K-TRACTN D2A 17.5R25 1*$2,039.71 37% $0.00 $1,285.02 263397 Off The Road Bridgestone V-STL K-TRACTN D2A 20.5R25 1*$2,948.13 37% $0.00 $1,857.32 263400 Off The Road Bridgestone V-STL K-TRACTN D2A 23.5R25 1*$3,759.29 37% $0.00 $2,368.35 275611 Off The Road Bridgestone V-STL K-TRACTN D2A 26.5R25 1*$4,800.00 37% $0.00 $3,024.00 261351 Off The Road Bridgestone V-STL K-TRACTN E1A 23.5R25 2*$3,999.39 37% $0.00 $2,519.62 275638 Off The Road Bridgestone V-STL K-TRACTN E1A 26.5R25 2*$4,907.85 37% $0.00 $3,091.95 419915 Off The Road Bridgestone V-STL K-TRACTN E1A 37.5R39 2* $20,396.06 37% $0.00 $12,849.52 263346 Off The Road Bridgestone V-STL K-TRACTN E2A 14.00R24 3*$2,182.47 37% $0.00 $1,374.96 276235 Off The Road Bridgestone V-STL K-TRACTN E2A 29.5R29 2* $11,405.72 37% $0.00 $7,185.60 296341 Off The Road Bridgestone V-STL K-TRACTN EG2 17.5R25 1*$2,039.71 37% $0.00 $1,285.02 263354 Off The Road Bridgestone V-STL K-TRACTN G2A 14.00R24 1*$1,759.60 37% $0.00 $1,108.55 284971 Off The Road Bridgestone V-STL K-TRACTN G2A 16.00R24 1*$2,679.96 37% $0.00 $1,688.37 420220 Off The Road Bridgestone V-STL L-TRACTN DE2 750/65R25 MS $7,759.76 37% $0.00 $4,888.65 421952 Off The Road Bridgestone V-STL L-TRACTN DE2 20.5R25 MS $3,321.75 37% $0.00 $2,092.70 421960 Off The Road Bridgestone V-STL L-TRACTN DE2 23.5R25 MS $4,337.33 37% $0.00 $2,732.52 421979 Off The Road Bridgestone V-STL L-TRACTN DE2 26.5R25 MS $6,003.41 37% $0.00 $3,782.15 421987 Off The Road Bridgestone V-STL L-TRACTN DE2 29.5R25 MS $8,209.67 37% $0.00 $5,172.09 427985 Off The Road Bridgestone V-STL L-TRACTN E1A 37.25R35 2* $17,734.27 37% $0.00 $11,172.59 428172 Off The Road Bridgestone V-STL L-TRACTN E1A 40.5/75R39 2* $21,964.29 37% $0.00 $13,837.50 427645 Off The Road Bridgestone V-STL L-TRACTN E2A 33.25R29 2* $13,439.53 37% $0.00 $8,466.90 428002 Off The Road Bridgestone V-STL L-TRACTN E2A 37.25R35 2* $17,734.27 37% $0.00 $11,172.59 428138 Off The Road Bridgestone V-STL L-TRACTN E2A 40.5/75R39 2* $21,964.29 37% $0.00 $13,837.50 000470 Off The Road Bridgestone V-STL L-TRACTN S DE2 875/65R29 MS $14,183.33 37% $0.00 $8,935.50 422738 Off The Road Bridgestone V-STL L-TRACTN S DE2 23.5R25 MS $5,871.46 37% $0.00 $3,699.02 424102 Off The Road Bridgestone V-STL L-TRACTN S DE2 20.5R25 MS $4,111.86 37% $0.00 $2,590.47 422711 Off The Road Bridgestone V-STL L-TRACTN S E2A 26.5R25 2*$7,828.98 37% $0.00 $4,932.26 422916 Off The Road Bridgestone V-STL L-TRACTN S E2A 29.5R25 2* $10,785.80 37% $0.00 $6,795.05 427560 Off The Road Bridgestone V-STL L-TRACTN S E2A 750/65R25 2*$9,365.79 37% $0.00 $5,900.45 418110 Off The Road Bridgestone V-STL M-TRACTN D2A 20.5R25 1*$3,066.05 37% $0.00 $1,931.61 418137 Off The Road Bridgestone V-STL M-TRACTN D2A 23.5R25 1*$3,977.76 37% $0.00 $2,505.99 418773 Off The Road Bridgestone V-STL M-TRACTN D2A 23.5R25 2*$4,253.54 37% $0.00 $2,679.73 419346 Off The Road Bridgestone V-STL M-TRACTN D2A 17.5R25 1*$2,158.67 37% $0.00 $1,359.96 419672 Off The Road Bridgestone V-STL M-TRACTN D2A 26.5R25 1*$5,336.12 37% $0.00 $3,361.76 419680 Off The Road Bridgestone V-STL M-TRACTN D2A 29.5R25 1*$7,090.31 37% $0.00 $4,466.90 418161 Off The Road Bridgestone V-STL M-TRACTN E1A 20.5R25 2*$3,163.39 37% $0.00 $1,992.94 418196 Off The Road Bridgestone V-STL M-TRACTN E1A 23.5R25 2*$4,253.54 37% $0.00 $2,679.73 419311 Off The Road Bridgestone V-STL M-TRACTN E1A 26.5R25 2*$5,588.11 37% $0.00 $3,520.51 419338 Off The Road Bridgestone V-STL M-TRACTN E1A 29.5R25 2*$8,034.46 37% $0.00 $5,061.71 422207 Off The Road Bridgestone V-STL M-TRACTN E3A 30.00R51 2* $28,709.50 37% $0.00 $18,086.99 003542 Off The Road Bridgestone V-STL M-TRACTN P E1A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 422479 Off The Road Bridgestone V-STL M-TRACTN P E1A 27.00R49 2* $16,241.97 37% $0.00 $10,232.44 422746 Off The Road Bridgestone V-STL M-TRACTN P E1A 18.00R33 2*$7,328.24 37% $0.00 $4,616.79 422770 Off The Road Bridgestone V-STL M-TRACTN P E1A 21.00R35 2* $11,355.75 37% $0.00 $7,154.12 422460 Off The Road Bridgestone V-STL M-TRACTN P E2A 27.00R49 2* $16,241.97 37% $0.00 $10,232.44 422789 Off The Road Bridgestone V-STL M-TRACTN P E2A 21.00R35 2* $11,355.75 37% $0.00 $7,154.12 422991 Off The Road Bridgestone V-STL M-TRACTN P E2A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 423866 Off The Road Bridgestone V-STL M-TRACTN P E2A 18.00R33 2*$7,328.24 37% $0.00 $4,616.79 428818 Off The Road Bridgestone V-STL M-TRACTN P E2A 21.00R33 2*$9,787.58 37% $0.00 $6,166.18 003035 Off The Road Bridgestone V-STL M-TRACTN P E3A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 422461 Off The Road Bridgestone V-STL M-TRACTN P E3A 27.00R49 2* $16,241.97 37% $0.00 $10,232.44 422754 Off The Road Bridgestone V-STL M-TRACTN P LS E2A 18.00R33 2*$7,328.24 37% $0.00 $4,616.79 423009 Off The Road Bridgestone V-STL M-TRACTN P LS E2A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 423106 Off The Road Bridgestone V-STL M-TRACTN P LS E2A 27.00R49 2* $16,241.97 37% $0.00 $10,232.44 418323 Off The Road Bridgestone V-STL M-TRACTN S E2A 18.00R25 2*$5,797.92 37% $0.00 $3,652.69 422347 Off The Road Bridgestone V-STL M-TRACTN S E2A 16.00R25 2*$3,751.72 37% $0.00 $2,363.58 295213 Off The Road Bridgestone V-STL M-TRACTN S E3A 14.00R25 3*$2,805.00 37% $0.00 $1,767.15 157376 Off The Road Bridgestone V-STL N-LUG D2A 14.00R20 2*$2,487.45 37% $0.00 $1,567.09 429277 Off The Road Bridgestone V-STL N-LUG D2A 35/65R33 2* $14,391.14 37% $0.00 $9,066.42 429855 Off The Road Bridgestone V-STL N-LUG D2A 45/65R45 2* $29,600.66 37% $0.00 $18,648.42 003991 Off The Road Bridgestone V-STL N-TRACTN D2A 29.5R29 2* $14,308.25 37% $0.00 $9,014.20 423971 Off The Road Bridgestone V-STL N-TRACTN DE2 26.5R25 MS $8,220.43 37% $0.00 $5,178.87 424196 Off The Road Bridgestone V-STL N-TRACTN DE2 29.5R25 MS $10,794.45 37% $0.00 $6,800.50 003789 Off The Road Bridgestone V-STL N-TRACTN DUH 35/65R33 MT $13,972.11 37% $0.00 $8,802.43 418498 Off The Road Bridgestone V-STL R-LUG E1A 33.25R35 2* $16,110.40 37% $0.00 $10,149.55 418501 Off The Road Bridgestone V-STL R-LUG E1A 40.5/75R39 2* $20,894.58 37% $0.00 $13,163.59 419591 Off The Road Bridgestone V-STL R-LUG E1A 29.5R35 2* $14,228.75 37% $0.00 $8,964.11 418552 Off The Road Bridgestone V-STL R-LUG E3A 27.00R49 2* $14,126.55 37% $0.00 $8,899.73 275883 Off The Road Bridgestone V-STL R-LUG S E1A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 275905 Off The Road Bridgestone V-STL R-LUG S E1A 27.00R49 2* $15,850.00 37% $0.00 $9,985.50 263419 Off The Road Bridgestone V-STL R-LUG S E2A 14.00R25 3*$2,862.73 37% $0.00 $1,803.52 276340 Off The Road Bridgestone V-STL R-LUG S E2A 27.00R49 2* $15,850.00 37% $0.00 $9,985.50 419141 Off The Road Bridgestone V-STL R-LUG S E2A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 420042 Off The Road Bridgestone V-STL R-LUG S E3A 27.00R49 2* $15,850.00 37% $0.00 $9,985.50 420603 Off The Road Bridgestone V-STL R-LUG S E3A 30.00R51 2* $33,776.33 37% $0.00 $21,279.09 423203 Off The Road Bridgestone V-STL R-LUG S IDU 16.00R25 2*$3,992.90 37% $0.00 $2,515.53 419648 Off The Road Bridgestone V-STL R-LUG S LS E2A 27.00R49 2* $15,850.00 37% $0.00 $9,985.50 422169 Off The Road Bridgestone V-STL R-LUG S LS E2A 24.00R35 2* $12,943.28 37% $0.00 $8,154.27 431385 Off The Road Bridgestone V-STL ROCK E-PREM E1A 27.00R49 2* $16,449.62 37% $0.00 $10,363.26 431402 Off The Road Bridgestone V-STL ROCK E-PREM E2A 27.00R49 2* $16,449.62 37% $0.00 $10,363.26 431419 Off The Road Bridgestone V-STL ROCK E-PREM E2A LS 27.00R49 2* $16,449.62 37% $0.00 $10,363.26 431368 Off The Road Bridgestone V-STL ROCK E-PREM E3A 27.00R49 2* $16,449.62 37% $0.00 $10,363.26 005175 Off The Road Bridgestone V-STL ROCK EXTR V-OPRTN E2A 27.00R49 2* $15,970.00 37% $0.00 $10,061.10 003798 Off The Road Bridgestone V-STL ROCK PREM SERV E1A 33.00R51 2* $56,218.43 37% $0.00 $35,417.61 003795 Off The Road Bridgestone V-STL ROCK PREM SERV E2A 33.00R51 2* $56,218.43 37% $0.00 $35,417.61 003797 Off The Road Bridgestone V-STL ROCK PREM SERV E3A 33.00R51 2* $56,218.43 37% $0.00 $35,417.61 003796 Off The Road Bridgestone V-STL ROCK PREM SERV LS E2A 33.00R51 2* $56,218.43 37% $0.00 $35,417.61 431504 Off The Road Bridgestone V-STL ROCK QUARRY PREM E2A 18.00R33 2*$7,471.00 37% $0.00 $4,706.73 431521 Off The Road Bridgestone V-STL ROCK QUARRY PREM E2A 24.00R35 2* $13,105.67 37% $0.00 $8,256.57 427900 Off The Road Bridgestone V-STL ROCK QUARRY PREM E2A L24.00R35 2* $13,105.67 37% $0.00 $8,256.57 003356 Off The Road Bridgestone V-STL S-BLOCK 14.00R24 L $2,309.00 37% $0.00 $1,454.67 003360 Off The Road Bridgestone V-STL S-BLOCK 14.00R25 L $2,607.50 37% $0.00 $1,642.73 299367 Off The Road Bridgestone V-STL S-BLOCK E2A 14.00R24 3*$2,309.00 37% $0.00 $1,454.67 150908 Off The Road Bridgestone V-STL SMOOTH TREAD-MS D2A 9.00R20 2*$1,674.16 37% $0.00 $1,054.72 150916 Off The Road Bridgestone V-STL SMOOTH TREAD-MS D2A 12.00R20 2*$2,319.82 37% $0.00 $1,461.49 150924 Off The Road Bridgestone V-STL SMOOTH TREAD-MS D2A 12.00R24 2*$2,400.93 37% $0.00 $1,512.59 211240 Off The Road Bridgestone V-STL SMOOTH TREAD-MS D2A 14.00R24 2*$3,646.82 37% $0.00 $2,297.50 422282 Off The Road Bridgestone V-STL SMOOTH TREAD-MS D2A 18.00R25 2*$9,508.55 37% $0.00 $5,990.39 423785 Off The Road Bridgestone V-STL SMOOTH TREAD-MS IDU 18.00R25 2*$9,508.55 37% $0.00 $5,990.39 004604 Off The Road Bridgestone V-STL SMOOTH TREAD-MS2 D2A 26.5R25 2* $10,755.84 37% $0.00 $6,776.18 004605 Off The Road Bridgestone V-STL SMOOTH TREAD-MS2 D2A 29.5R29 2* $21,437.38 37% $0.00 $13,505.55 004724 Off The Road Bridgestone V-STL SMOOTH TREAD-MS2 D2A 17.5R25 2*$4,380.08 37% $0.00 $2,759.45 Page 23 of 56102 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 425078 Off The Road Bridgestone V-STL SNOW WEDGE 385/95R25 $2,736.20 37% $0.00 $1,723.81 005536 Off The Road Bridgestone V-STL SNOW WEDGE AS 14.00R24 1*$2,338.20 37% $0.00 $1,473.07 005537 Off The Road Bridgestone V-STL SNOW WEDGE AS 20.5R25 1*$3,811.21 37% $0.00 $2,401.06 004682 Off The Road Bridgestone V-STL SNOW WEDGE AS G2A 17.5R25 1*$2,394.44 37% $0.00 $1,508.50 431742 Off The Road Bridgestone V-STL SNOW WEDGE D2A 600/65R25 1*$4,559.60 37% $0.00 $2,872.55 422851 Off The Road Bridgestone V-STL SNOW WEDGE DE2 20.5R25 MS $3,811.21 37% $0.00 $2,401.06 423750 Off The Road Bridgestone V-STL SNOW WEDGE DE2 23.5R25 MS $4,679.65 37% $0.00 $2,948.18 420387 Off The Road Bridgestone V-STL SNOW WEDGE DG2 17.5R25 1*$2,394.44 37% $0.00 $1,508.50 293970 Off The Road Bridgestone V-STL SNOW WEDGE G2A 14.00R24 1*$2,338.20 37% $0.00 $1,473.07 293997 Off The Road Bridgestone V-STL SNOW WEDGE G2A 16.00R24 1*$2,862.73 37% $0.00 $1,803.52 000996 Off The Road Bridgestone V-STL SUPER DEEP ROCK 20.5R25 1*$7,246.05 37% $0.00 $4,565.01 000997 Off The Road Bridgestone V-STL SUPER DEEP ROCK 20.5R25 2*$7,462.35 37% $0.00 $4,701.28 002111 Off The Road Bridgestone V-STL SUPER DEEP TRACTN 35/65R33 2* $15,067.94 37% $0.00 $9,492.80 423548 Off The Road Bridgestone V-STL SUPER DEEP TRACTN D2A 23.5R25 1*$7,339.06 37% $0.00 $4,623.61 423955 Off The Road Bridgestone V-STL SUPER DEEP TRACTN D2A 26.5R25 1*$9,655.63 37% $0.00 $6,083.05 424145 Off The Road Bridgestone V-STL SUPER DEEP TRACTN D2A 29.5R25 2* $12,777.92 37% $0.00 $8,050.09 424420 Off The Road Bridgestone V-STL SUPER DEEP TRACTN D2A 29.5R29 2* $14,332.50 37% $0.00 $9,029.48 424099 Off The Road Bridgestone V-STL TRACTN STABILITY D2A 650/65R25 1*$5,964.47 37% $0.00 $3,757.62 424277 Off The Road Bridgestone V-STL TRACTN STABILITY D2A 775/65R29 1*$9,603.56 37% $0.00 $6,050.24 429821 Off The Road Bridgestone V-STL TRACTN STABILITY D2A 550/65R25 1*$4,641.80 37% $0.00 $2,924.33 429838 Off The Road Bridgestone V-STL TRACTN STABILITY D2A 750/65R25 1*$8,376.22 37% $0.00 $5,277.02 431283 Off The Road Bridgestone V-STL TRACTN STABILITY DE2 875/65R29 MS $12,296.01 37% $0.00 $7,746.49 424757 Off The Road Bridgestone V-STL ULTRA TRACTN DE2 365/80R20 1*$1,138.82 37% $0.00 $717.46 425095 Off The Road Bridgestone V-STL ULTRA TRACTN DE2 335/80R20 1*$1,153.96 37% $0.00 $726.99 425469 Off The Road Bridgestone V-STL ULTRA TRACTN DE2 405/70R20 1*$1,452.45 37% $0.00 $915.04 420344 Off The Road Bridgestone V-STL ULTRA TRACTN DG2 20.5R25 1*$2,337.12 37% $0.00 $1,472.39 422703 Off The Road Bridgestone V-STL ULTRA TRACTN DG2 23.5R25 1*$3,409.97 37% $0.00 $2,148.28 422827 Off The Road Bridgestone V-STL ULTRA TRACTN DG2 17.5R25 1*$2,013.75 37% $0.00 $1,268.66 424609 Off The Road Bridgestone V-STL ULTRA TRACTN DG2 15.5R25 2*$1,860.18 37% $0.00 $1,171.91 293954 Off The Road Bridgestone V-STL ULTRA TRACTN G2A 14.00R24 1*$1,655.78 37% $0.00 $1,043.14 299804 Off The Road Bridgestone V-STL ULTRA TRACTN G2A 13.00R24 1*$1,529.24 37% $0.00 $963.42 378032 Farm Regency AG FRONT 3RIB 10.00-16 8 $195.00 23% $0.00 $150.15 378253 Farm Regency AG FRONT 3RIB 6.00-16 6 $82.00 23% $0.00 $63.14 378270 Farm Regency AG FRONT 4RIB 11.00-16 8 $219.00 23% $0.00 $168.63 378287 Farm Regency AG IMPLEMENT 9.5L-15 8 $102.00 23% $0.00 $78.54 378304 Farm Regency AG IMPLEMENT 11L-15 8 $103.00 23% $0.00 $79.31 378321 Farm Regency AG IMPLEMENT 12.5L-15 10 $141.00 23% $0.00 $108.57 378338 Farm Regency AG IMPLEMENT 7.60-15 8 $100.00 23% $0.00 $77.00 378763 Farm Regency AG IMPLEMENT 9.5L-14 8 $106.00 23% $0.00 $81.62 382333 Farm Regency AG TRACTOR 5-12 4 $54.00 23% $0.00 $41.58 382350 Farm Regency AG TRACTOR 6.00-16 4 $111.00 23% $0.00 $85.47 382367 Farm Regency AG TRACTOR 6-12 4 $64.00 23% $0.00 $49.28 382384 Farm Regency AG TRACTOR 7-14 4 $100.00 23% $0.00 $77.00 382401 Farm Regency AG TRACTOR 6-14 4 $74.00 23% $0.00 $56.98 382418 Farm Regency AG TRACTOR 7-16 6 $133.00 23% $0.00 $102.41 382435 Farm Regency AG TRACTOR 8-16 6 $146.00 23% $0.00 $112.42 310514 Farm Firestone ALL NON-SKID FARM 16.5L-16.1 6 $419.00 23% $0.00 $322.63 317365 Farm Firestone ALL NON-SKID FARM 16.5L-16.1 10 $564.00 23% $0.00 $434.28 325015 Farm Firestone ALL NON-SKID FARM 13.50-16.1 10 $432.00 23% $0.00 $332.64 306096 Farm Firestone ALL NON-SKID TRACTOR 9.5-24 4 $445.23 23% $0.00 $342.83 306193 Farm Firestone ALL NON-SKID TRACTOR 13.6-28 6 $815.39 23% $0.00 $627.85 315958 Farm Firestone ALL NON-SKID TRACTOR 18.4-26 6 $1,286.51 23% $0.00 $990.61 322296 Farm Firestone ALL NON-SKID TRACTOR 24.5-32 12 $2,621.98 23% $0.00 $2,018.92 323527 Farm Firestone ALL NON-SKID TRACTOR 23.1-26 12 $1,580.17 23% $0.00 $1,216.73 345377 Farm Firestone ALL NON-SKID TRACTOR 23.1-26 8 $1,363.43 23% $0.00 $1,049.84 351008 Farm Firestone ALL NON-SKID TRACTOR 28L-26 12 $1,983.27 23% $0.00 $1,527.12 351709 Farm Firestone ALL NON-SKID TRACTOR 16.9-24 6 $949.65 23% $0.00 $731.23 351733 Farm Firestone ALL NON-SKID TRACTOR 8.3-24 4 $351.55 23% $0.00 $270.69 357758 Farm Firestone ALL NON-SKID TRACTOR 30.5L-32 16 $3,525.63 23% $0.00 $2,714.74 357820 Farm Firestone ALL NON-SKID TRACTOR 35.5L-32 20 $5,417.52 23% $0.00 $4,171.49 358789 Farm Firestone ALL NON-SKID TRACTOR 16.9-24 10 $1,147.47 23% $0.00 $883.55 359556 Farm Firestone ALL NON-SKID TRACTOR 14.9-24 6 $809.62 23% $0.00 $623.41 359904 Farm Firestone ALL NON-SKID TRACTOR 30.5L-32 14 $2,910.64 23% $0.00 $2,241.19 360384 Farm Firestone ALL NON-SKID TRACTOR 24.5-32 16 $3,543.90 23% $0.00 $2,728.80 362220 Farm Firestone ALL NON-SKID TRACTOR 28L-26 16 $2,310.75 23% $0.00 $1,779.28 369753 Farm Firestone ALL NON-SKID TRACTOR 18.4-26 12 $1,684.16 23% $0.00 $1,296.80 362085 Farm Firestone ALL NON-SKID TRACTOR II 28L-26 16 $2,100.00 23% $0.00 $1,617.00 309281 Farm Firestone ALL TRACTION UTILITY 16.9-24 8 $751.49 23% $0.00 $578.65 315486 Farm Firestone ALL TRACTION UTILITY 17.5L-24 8 $781.91 23% $0.00 $602.07 351040 Farm Firestone ALL TRACTION UTILITY 420/70-24 6 $733.84 23% $0.00 $565.06 351849 Farm Firestone ALL TRACTION UTILITY 14.9-24 8 $675.19 23% $0.00 $519.90 358584 Farm Firestone ALL TRACTION UTILITY 14.9-24 12 $958.29 23% $0.00 $737.88 374683 Farm Firestone CHAMPION GUIDE GRIP 3-RIB 6.50-16 6 $133.00 23% $0.00 $102.41 374700 Farm Firestone CHAMPION GUIDE GRIP 3-RIB 6.00-16 6 $109.00 23% $0.00 $83.93 374751 Farm Firestone CHAMPION GUIDE GRIP 3-RIB 7.50-16 8 $150.00 23% $0.00 $115.50 350877 Farm Firestone CHAMPION GUIDE GRIP 3-RIB HD 10.00-16 8 $200.00 23% $0.00 $154.00 350885 Farm Firestone CHAMPION GUIDE GRIP 3-RIB HD 11.00-16 8 $248.00 23% $0.00 $190.96 375142 Farm Firestone CHAMPION GUIDE GRIP 3-RIB HD 11L-15 8 $198.00 23% $0.00 $152.46 357847 Farm Firestone CHAMPION GUIDE GRIP 3-RIB HDS10.00-16 8 $265.00 23% $0.00 $204.05 357855 Farm Firestone CHAMPION GUIDE GRIP 3-RIB HDS11.00-16 8 $315.00 23% $0.00 $242.55 339865 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 10.00-16 8 $196.00 23% $0.00 $150.92 339873 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 11.00-16 8 $262.00 23% $0.00 $201.74 339938 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 16.5L-16.1 8 $656.00 23% $0.00 $505.12 342602 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 11.00-16 12 $412.00 23% $0.00 $317.24 359432 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 14L-16.1 12 $531.00 23% $0.00 $408.87 374717 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 7.50-16 8 $156.00 23% $0.00 $120.12 375227 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 9.5L-15 8 $188.00 23% $0.00 $144.76 376570 Farm Firestone CHAMPION GUIDE GRIP 4-RIB 11L-15 8 $190.00 23% $0.00 $146.30 357898 Farm Firestone CHAMPION GUIDE GRIP 4-RIB SS 10.00-16 8 $268.00 23% $0.00 $206.36 357901 Farm Firestone CHAMPION GUIDE GRIP 4-RIB SS 11.00-16 8 $327.00 23% $0.00 $251.79 322687 Farm Firestone CHAMPION GUIDE GRIP TRAC HD 14L-16.1 10 $381.00 23% $0.00 $293.37 352594 Farm Firestone CHAMPION GUIDE GRIP TRAC HD 7.50-20 6 $213.00 23% $0.00 $164.01 003147 Farm Firestone CHAMPION HYDRO ND 290/85D38 $536.55 23% $0.00 $413.14 373765 Farm Firestone CHAMPION HYDRO ND 380/85D24 $622.82 23% $0.00 $479.57 000917 Farm Firestone CHAMPION SPADE GRIP 13.6-46 6 $1,710.29 23% $0.00 $1,316.92 311189 Farm Firestone CHAMPION SPADE GRIP 23.1-30 8 $2,425.06 23% $0.00 $1,867.30 311626 Farm Firestone CHAMPION SPADE GRIP 24.5-32 10 $2,351.33 23% $0.00 $1,810.52 326445 Farm Firestone CHAMPION SPADE GRIP 18.4-26 10 $1,283.67 23% $0.00 $988.43 342432 Farm Firestone CHAMPION SPADE GRIP 18.4-30 10 $1,300.00 23% $0.00 $1,001.00 358231 Farm Firestone CHAMPION SPADE GRIP 30.5L-32 14 $3,240.94 23% $0.00 $2,495.52 358258 Farm Firestone CHAMPION SPADE GRIP 35.5L-32 12 $6,083.56 23% $0.00 $4,684.34 362647 Farm Firestone CHAMPION SPADE GRIP 23.1-26 10 $2,161.00 23% $0.00 $1,663.97 379868 Farm Firestone CHAMPION SPADE GRIP 28L-26 16 $3,318.61 23% $0.00 $2,555.33 Page 24 of 56103 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 379885 Farm Firestone CHAMPION SPADE GRIP 13.6-38 6 $966.55 23% $0.00 $744.24 000543 Farm Firestone DESTINATION FARM IF240/80R15 $214.40 23% $0.00 $165.09 000895 Farm Firestone DESTINATION FARM VF285/70R19.5 $596.18 23% $0.00 $459.06 000896 Farm Firestone DESTINATION FARM VF265/70R19.5 $564.62 23% $0.00 $434.76 000898 Farm Firestone DESTINATION FARM VF255/70R22.5 $508.72 23% $0.00 $391.71 000899 Farm Firestone DESTINATION FARM VF385/65R22.5 $860.53 23% $0.00 $662.61 001581 Farm Firestone DESTINATION FARM VF245/70R19.5 $460.92 23% $0.00 $354.91 001583 Farm Firestone DESTINATION FARM VF295/75R22.5 $551.08 23% $0.00 $424.33 001584 Farm Firestone DESTINATION FARM VF445/65R22.5 $947.32 23% $0.00 $729.44 001585 Farm Firestone DESTINATION FARM IF265/85R15 $245.41 23% $0.00 $188.97 003166 Farm Firestone DESTINATION FARM IF320/70R15 $377.19 23% $0.00 $290.44 004844 Farm Firestone DESTINATION FARM IF280/70R15 $274.03 23% $0.00 $211.00 005514 Farm Firestone DESTINATION FARM IF210/75R15 $165.00 23% $0.00 $127.05 006264 Farm Firestone DESTINATION TURF IF320/70R15 $377.19 23% $0.00 $290.44 007119 Farm Firestone DESTINATION TURF IF320/65R15 $365.00 23% $0.00 $281.05 313424 Farm Firestone DUO RIB PLANTER 7.50-20 4 $261.00 23% $0.00 $200.97 325864 Farm Firestone DUO RIB PLANTER 7.60-15 6 $162.00 23% $0.00 $124.74 360503 Farm Firestone DURAFORCE DEEP TREAD 395/55D16.5NHS 12 $590.10 23% $0.00 $454.38 362034 Farm Firestone FARM IMP STUBBLE STOMPER 5.90-15 4 $104.00 23% $0.00 $80.08 339148 Farm Firestone FARM IMPLEMENT 8.5L-14 6 $115.00 23% $0.00 $88.55 339199 Farm Firestone FARM IMPLEMENT 6.00-16 6 $105.00 23% $0.00 $80.85 339288 Farm Firestone FARM IMPLEMENT 5.90-15 4 $96.00 23% $0.00 $73.92 339326 Farm Firestone FARM IMPLEMENT 7.50-20 6 $194.00 23% $0.00 $149.38 339369 Farm Firestone FARM IMPLEMENT 7.60-15 8 $118.00 23% $0.00 $90.86 339377 Farm Firestone FARM IMPLEMENT 9.5L-15 8 $125.00 23% $0.00 $96.25 339482 Farm Firestone FARM IMPLEMENT 11L-15 12 $181.00 23% $0.00 $139.37 339547 Farm Firestone FARM IMPLEMENT 11L-15 8 $124.00 23% $0.00 $95.48 339598 Farm Firestone FARM IMPLEMENT 12.5L-15 10 $182.00 23% $0.00 $140.14 339636 Farm Firestone FARM IMPLEMENT 16.5L-16.1 10 $459.00 23% $0.00 $353.43 342483 Farm Firestone FARM IMPLEMENT 16.5L-16.1 14 $544.00 23% $0.00 $418.88 350028 Farm Firestone FARM IMPLEMENT 11L-14 8 $153.00 23% $0.00 $117.81 354538 Farm Firestone FARM IMPLEMENT 12.5L-15 12 $214.00 23% $0.00 $164.78 354686 Farm Firestone FARM IMPLEMENT 14L-16.1 8 $341.00 23% $0.00 $262.57 355860 Farm Firestone FARM IMPLEMENT 9.5L-15 12 $172.00 23% $0.00 $132.44 356840 Farm Firestone FARM IMPLEMENT 12.5L-16 14 $251.00 23% $0.00 $193.27 357804 Farm Firestone FARM IMPLEMENT 27X9.50-15 8 $152.00 23% $0.00 $117.04 358940 Farm Firestone FARM IMPLEMENT 9.5L-14 8 $123.00 23% $0.00 $94.71 359831 Farm Firestone FARM IMPLEMENT 11L-16 8 $177.00 23% $0.00 $136.29 375652 Farm Firestone FARM IMPLEMENT 6.70-15 6 $99.00 23% $0.00 $76.23 376876 Farm Firestone FARM IMPLEMENT 14L-16.1 14 $412.00 23% $0.00 $317.24 378457 Farm Firestone FARM IMPLEMENT 12.5L-15 18 $268.00 23% $0.00 $206.36 379460 Farm Firestone FARM IMPLEMENT 27X8.50-15 8 $161.00 23% $0.00 $123.97 344362 Farm Bridgestone FARM SERVICE DIA 6-14 4 $134.00 23% $0.00 $103.18 344699 Farm Bridgestone FARM SERVICE DIA 6-12 4 $128.00 23% $0.00 $98.56 344869 Farm Bridgestone FARM SERVICE DIA 11.2-24 4 $611.00 23% $0.00 $470.47 378695 Farm Bridgestone FARM SERVICE LUG-18 8.3-22 6 $518.00 23% $0.00 $398.86 344443 Farm Bridgestone FARM SERVICE LUG-M 5-14 4 $129.00 23% $0.00 $99.33 344494 Farm Bridgestone FARM SERVICE LUG-M 8-16 4 $146.00 23% $0.00 $112.42 355925 Farm Bridgestone FARM SERVICE LUG-M 8-18 6 $151.00 23% $0.00 $116.27 363752 Farm Bridgestone FARM SERVICE LUG-M 9.5-22 6 $605.00 23% $0.00 $465.85 344648 Farm Bridgestone FARM SERVICE RIB 4.50-10 4 $137.00 23% $0.00 $105.49 318507 Farm Firestone FARM TIRE 21.5L-16.1 10 $688.00 23% $0.00 $529.76 325848 Farm Firestone FARM TIRE 21.5L-16.1 14 $800.00 23% $0.00 $616.00 329614 Farm Firestone FARM TIRE 10.00-15 8 $188.00 23% $0.00 $144.76 359777 Farm Firestone FARM TIRE 19L-16.1 12 $582.00 23% $0.00 $448.14 000929 Farm Firestone FIELD & ROAD 11.2-38 6 $604.13 23% $0.00 $465.18 304808 Farm Firestone FIELD & ROAD 11.2-36 4 $606.00 23% $0.00 $466.62 304840 Farm Firestone FIELD & ROAD 12.4-38 4 $590.86 23% $0.00 $454.96 304921 Farm Firestone FIELD & ROAD 12.4-38 6 $635.00 23% $0.00 $488.95 354805 Farm Firestone FIELD & ROAD 12.4-38 8 $650.00 23% $0.00 $500.50 355003 Farm Firestone FIELD & ROAD 11.2-38 4 $470.05 23% $0.00 $361.94 361623 Farm Firestone FIELD & ROAD 11.2-28 6 $477.26 23% $0.00 $367.49 314420 Farm Firestone FLOTATION 23 31X15.50-15 8 $395.05 23% $0.00 $304.19 361984 Farm Firestone FLOTATION 23 48X31.00-20 14 $2,320.40 23% $0.00 $1,786.71 375465 Farm Firestone FLOTATION 23 66X43.00-25 20 $6,195.00 23% $0.00 $4,770.15 340693 Farm Firestone FLOTATION 23 DEEP TREAD 66X43.00-25 10 $5,979.96 23% $0.00 $4,604.57 358312 Farm Firestone FLOTATION 23 DEEP TREAD 66X43.00-25 16 $5,995.47 23% $0.00 $4,616.51 358835 Farm Firestone FLOTATION 23 DEEP TREAD 73X44.00-32 16 $8,233.79 23% $0.00 $6,340.02 361976 Farm Firestone FLOTATION 23 DEEP TREAD 48X31.00-20 14 $2,792.36 23% $0.00 $2,150.12 369702 Farm Firestone FLOTATION 23 DEEP TREAD 76X50.00-32 20 $11,202.56 23% $0.00 $8,625.97 343366 Farm Firestone FLOTATION 23 DT LOGGER 73X44.00-32 16 $10,125.12 23% $0.00 $7,796.34 354392 Farm Firestone FLOTATION 23 DT LOGGER 66X43.00-25 14 $7,827.57 23% $0.00 $6,027.23 354422 Farm Firestone FLOTATION 23 DT LOGGER 66X43.00-26 14 $8,073.29 23% $0.00 $6,216.43 354899 Farm Firestone FLOTATION 23 DT LOGGER 67X34.00-26 14 $7,188.99 23% $0.00 $5,535.52 354902 Farm Firestone FLOTATION 23 DT LOGGER 67X34.00-25 14 $6,649.09 23% $0.00 $5,119.80 359130 Farm Firestone FLOTATION 23 DT LOGGER 76X50.00B32 16 $13,513.90 23% $0.00 $10,405.70 373102 Farm Firestone FLOTATION 23 DT LOGGER 54X37.00-25 20 $6,785.08 23% $0.00 $5,224.51 354325 Farm Firestone FLOTATION 23 XDT LOGGER 66X43.00-25 14 $9,687.89 23% $0.00 $7,459.68 371674 Farm Firestone FLOTATION ALL TERRAIN WTP 66X44.00-25 20 $8,883.59 23% $0.00 $6,840.36 360422 Farm Firestone FLOTATION FREE ROLLING 48X25.00-20 12 $2,126.58 23% $0.00 $1,637.47 359033 Farm Firestone FLOTATION IMPLEMENT 700/50-22.5 16 $1,754.00 23% $0.00 $1,350.58 364653 Farm Firestone FLOTATION IMPLEMENT 600/55-22.5 16 $1,622.00 23% $0.00 $1,248.94 371623 Farm Firestone FORESTRY ENVIRONMENTL LUG 710/45B26.5 20 $6,013.50 23% $0.00 $4,630.40 000407 Farm Firestone FORESTRY SPECIAL CRC 23.1-26 20 $4,513.23 23% $0.00 $3,475.19 006284 Farm Firestone FORESTRY SPECIAL CRC 24.5-32 20 $4,050.00 23% $0.00 $3,118.50 361771 Farm Firestone FORESTRY SPECIAL CRC 18.4-26 10 $1,935.90 23% $0.00 $1,490.64 361801 Farm Firestone FORESTRY SPECIAL CRC 23.1-26 14 $3,483.00 23% $0.00 $2,681.91 361887 Farm Firestone FORESTRY SPECIAL CRC 18.4-34 10 $2,815.28 23% $0.00 $2,167.77 362494 Farm Firestone FORESTRY SPECIAL CRC 28L-26 14 $4,007.64 23% $0.00 $3,085.88 364704 Farm Firestone FORESTRY SPECIAL CRC 24.5-32 16 $4,001.00 23% $0.00 $3,080.77 004444 Farm Firestone FORESTRY SPECIAL CRC SS 30.5L-32 32 $6,712.12 23% $0.00 $5,168.33 004445 Farm Firestone FORESTRY SPECIAL CRC SS DH35.5LB32 30 $7,969.69 23% $0.00 $6,136.66 004458 Farm Firestone FORESTRY SPECIAL CRC SS 28L-26 20 $4,450.00 23% $0.00 $3,426.50 362511 Farm Firestone FORESTRY SPECIAL CRC SS 28L-26 16 $4,250.00 23% $0.00 $3,272.50 371555 Farm Firestone FORESTRY SPECIAL CRC SS 30.5L-32 26 $6,788.56 23% $0.00 $5,227.19 371606 Farm Firestone FORESTRY SPECIAL CRC SS DH35.5LB32 24 $9,957.81 23% $0.00 $7,667.51 374666 Farm Firestone GUIDE GRIP 3-RIB 7.5L-15 6 $130.00 23% $0.00 $100.10 374564 Farm Firestone HIGHWAY SPECIAL 12.5L-15FI F $301.00 23% $0.00 $231.77 374581 Farm Firestone HIGHWAY SPECIAL 11L-15FI F $232.00 23% $0.00 $178.64 374598 Farm Firestone HIGHWAY SPECIAL 9.5L-15FI E $198.00 23% $0.00 $152.46 316024 Farm Firestone INDUSTRIAL SPECIAL 11L-15 8 $128.00 23% $0.00 $98.56 326011 Farm Firestone INDUSTRIAL SPECIAL 11L-15 10 $148.00 23% $0.00 $113.96 000912 Farm Firestone IRRIGATION SPECIAL 14.9-24 6 $541.34 23% $0.00 $416.83 Page 25 of 56104 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 321893 Farm Firestone IRRIGATION SPECIAL 11.2-24 4 $288.79 23% $0.00 $222.37 322377 Farm Firestone IRRIGATION SPECIAL 14.9-24 4 $447.29 23% $0.00 $344.41 342459 Farm Firestone IRRIGATION SPECIAL 14.9-24 4 $289.79 23% $0.00 $223.14 007000 Farm Firestone MAXI TRACTION 65 540/65R28 $1,609.00 23% $0.00 $1,238.93 323004 Farm Firestone NON-DIRECTNAL DUPLEX FARM 40X19-19.5 14 $1,561.00 23% $0.00 $1,201.97 000546 Farm Firestone PERFORMER 65 540/65R34 $2,199.28 23% $0.00 $1,693.45 000584 Farm Firestone PERFORMER 65 540/65R30 $2,210.14 23% $0.00 $1,701.81 003014 Farm Firestone PERFORMER 65 480/65R28 $2,207.56 23% $0.00 $1,699.82 003015 Farm Firestone PERFORMER 65 650/65R38 $4,319.65 23% $0.00 $3,326.13 004087 Farm Firestone PERFORMER 65 600/65R38 $3,177.27 23% $0.00 $2,446.50 000627 Farm Firestone PERFORMER 70 380/70R28 $1,593.05 23% $0.00 $1,226.65 002062 Farm Firestone PERFORMER 70 480/70R30 $2,419.98 23% $0.00 $1,863.38 002063 Farm Firestone PERFORMER 70 580/70R38 $3,176.85 23% $0.00 $2,446.17 003516 Farm Firestone PERFORMER 70 520/70R34 $2,923.45 23% $0.00 $2,251.06 004088 Farm Firestone PERFORMER 70 420/70R28 $751.32 23% $0.00 $578.52 004090 Farm Firestone PERFORMER 70 480/70R28 $2,281.44 23% $0.00 $1,756.71 379188 Farm Firestone PERFORMER 70 420/70R24 $706.15 23% $0.00 $543.74 379324 Farm Firestone PERFORMER 70 480/70R34 $2,315.03 23% $0.00 $1,782.57 379341 Farm Firestone PERFORMER 70 380/70R24 $1,558.95 23% $0.00 $1,200.39 379358 Farm Firestone PERFORMER 70 480/70R38 $3,157.83 23% $0.00 $2,431.53 379919 Farm Firestone PERFORMER 70 520/70R38 $3,250.19 23% $0.00 $2,502.65 381551 Farm Firestone PERFORMER 70 480/70R24 $2,020.68 23% $0.00 $1,555.92 382180 Farm Firestone PERFORMER 70 360/70R28 $1,582.32 23% $0.00 $1,218.39 000401 Farm Firestone PERFORMER 85 380/85R30 $1,360.00 23% $0.00 $1,047.20 000549 Farm Firestone PERFORMER 85 380/85R24 $844.18 23% $0.00 $650.02 000550 Farm Firestone PERFORMER 85 340/85R28 $1,570.92 23% $0.00 $1,209.61 000565 Farm Firestone PERFORMER 85 280/85R24 $553.42 23% $0.00 $426.13 000566 Farm Firestone PERFORMER 85 320/85R24 $718.19 23% $0.00 $553.01 000567 Farm Firestone PERFORMER 85 340/85R24 $756.00 23% $0.00 $582.12 000568 Farm Firestone PERFORMER 85 420/85R30 $1,272.03 23% $0.00 $979.46 000569 Farm Firestone PERFORMER 85 460/85R30 $1,362.42 23% $0.00 $1,049.06 000586 Farm Firestone PERFORMER 85 460/85R34 $2,602.77 23% $0.00 $2,004.13 000587 Farm Firestone PERFORMER 85 460/85R38 $2,925.64 23% $0.00 $2,252.74 000588 Farm Firestone PERFORMER 85 320/85R28 $523.07 23% $0.00 $402.76 000589 Farm Firestone PERFORMER 85 380/85R28 $1,520.69 23% $0.00 $1,170.93 000598 Farm Firestone PERFORMER 85 420/85R38 $2,628.18 23% $0.00 $2,023.70 000599 Farm Firestone PERFORMER 85 420/85R24 $765.52 23% $0.00 $589.45 000600 Farm Firestone PERFORMER 85 420/85R28 $2,208.52 23% $0.00 $1,700.56 000601 Farm Firestone PERFORMER 85 460/85R30 $2,380.72 23% $0.00 $1,833.15 000602 Farm Firestone PERFORMER 85 520/85R38 $3,174.77 23% $0.00 $2,444.57 000628 Farm Firestone PERFORMER 85 520/85R42 $3,807.96 23% $0.00 $2,932.13 004241 Farm Firestone PERFORMER 85 420/85R34 $2,479.41 23% $0.00 $1,909.15 382078 Farm Firestone PERFORMER 85 460/85R42 $3,456.00 23% $0.00 $2,661.12 007121 Farm Firestone PERFORMER EVO 380/85R30 $679.00 23% $0.00 $522.83 007122 Farm Firestone PERFORMER EVO 420/85R30 $864.00 23% $0.00 $665.28 007432 Farm Bridgestone PILLOW DIA 215/80D15 4 $323.00 23% $0.00 $248.71 344591 Farm Bridgestone PILLOW DIA 24X8.50-14 4 $263.00 23% $0.00 $202.51 344982 Farm Bridgestone PILLOW DIA 355/80D20 4 $884.00 23% $0.00 $680.68 340529 Farm Firestone POWER IMPLEMENT 7.60-15 6 $145.00 23% $0.00 $111.65 340561 Farm Firestone POWER IMPLEMENT 12.5L-15 8 $233.00 23% $0.00 $179.41 340618 Farm Firestone POWER IMPLEMENT 16.5L-16.1 6 $606.00 23% $0.00 $466.62 342467 Farm Firestone POWER IMPLEMENT 16.5L-16.1 10 $590.00 23% $0.00 $454.30 342688 Farm Firestone POWER IMPLEMENT 13.50-16.1 8 $461.00 23% $0.00 $354.97 359408 Farm Firestone POWER IMPLEMENT 21.5L-16.1 8 $940.00 23% $0.00 $723.80 359416 Farm Firestone POWER IMPLEMENT 21.5L-16.1 14 $1,359.00 23% $0.00 $1,046.43 310069 Farm Firestone POWER IMPLEMENT ND 5.00-15 4 $108.00 23% $0.00 $83.16 361992 Farm Firestone PULLER 2000 30.5L-32 HP $6,315.03 23% $0.00 $4,862.57 369685 Farm Firestone PULLER 2000 24.5-32 HP $5,865.64 23% $0.00 $4,516.54 002106 Farm Firestone R8000 UTILITY 400/80R24 $821.00 23% $0.00 $632.17 354740 Farm Firestone RADIAL 23 18.4R34 1*$1,543.58 23% $0.00 $1,188.56 354767 Farm Firestone RADIAL 23 15.5R38 1*$1,142.46 23% $0.00 $879.69 355399 Farm Firestone RADIAL 23 20.8R42 2*$2,295.32 23% $0.00 $1,767.40 359823 Farm Firestone RADIAL 23 18.4R38 2*$1,545.09 23% $0.00 $1,189.72 362204 Farm Firestone RADIAL 23 20.8R38 2*$2,023.11 23% $0.00 $1,557.79 362212 Farm Firestone RADIAL 23 18.4R42 3*$2,041.57 23% $0.00 $1,572.01 365027 Farm Firestone RADIAL 4000 280/70R18 $677.65 23% $0.00 $521.79 365843 Farm Firestone RADIAL 4000 360/70R20 ZZ $943.07 23% $0.00 $726.16 000403 Farm Firestone RADIAL 9000 650/65R38 $2,899.80 23% $0.00 $2,232.85 007435 Farm Firestone RADIAL 9000 380/90R46 $2,600.00 23% $0.00 $2,002.00 356263 Farm Firestone RADIAL 9000 230/95R48 $1,447.43 23% $0.00 $1,114.52 357774 Farm Firestone RADIAL 9000 320/90R46 $2,321.94 23% $0.00 $1,787.89 358118 Farm Firestone RADIAL 9000 320/90R50 $2,423.75 23% $0.00 $1,866.29 359092 Farm Firestone RADIAL 9000 320/85R38 B $1,560.00 23% $0.00 $1,201.20 359106 Farm Firestone RADIAL 9000 320/90R42 $1,960.44 23% $0.00 $1,509.54 359165 Farm Firestone RADIAL 9000 540/65R24 $2,185.68 23% $0.00 $1,682.97 359238 Farm Firestone RADIAL 9000 320/85R34 $1,599.99 23% $0.00 $1,231.99 359394 Farm Firestone RADIAL 9000 900/50R42 $6,114.87 23% $0.00 $4,708.45 359939 Farm Firestone RADIAL 9000 380/90R46 $2,417.49 23% $0.00 $1,861.47 361763 Farm Firestone RADIAL 9000 480/70R34 $2,701.46 23% $0.00 $2,080.12 361933 Farm Firestone RADIAL 9000 600/65R38 $3,413.10 23% $0.00 $2,628.09 362050 Farm Firestone RADIAL 9000 380/90R50 $2,761.39 23% $0.00 $2,126.27 362069 Farm Firestone RADIAL 9000 380/90R54 $3,188.79 23% $0.00 $2,455.37 363055 Farm Firestone RADIAL 9000 540/65R30 $2,410.36 23% $0.00 $1,855.98 365673 Farm Firestone RADIAL 9000 480/65R24 $1,755.35 23% $0.00 $1,351.62 362919 Farm Firestone RADIAL 9100 380/105R50 $3,384.79 23% $0.00 $2,606.29 000558 Farm Firestone RADIAL ALL TRACTION 23 IF420/80R46 $3,936.75 23% $0.00 $3,031.30 000560 Farm Firestone RADIAL ALL TRACTION 23 IF520/85R42CFO $3,806.14 23% $0.00 $2,930.73 000903 Farm Firestone RADIAL ALL TRACTION 23 IF900/60R32CFO $6,370.53 23% $0.00 $4,905.31 003149 Farm Firestone RADIAL ALL TRACTION 23 IF900/60R32CFO $6,535.00 23% $0.00 $5,031.95 343323 Farm Firestone RADIAL ALL TRACTION 23 14.9R46 4*$2,357.88 23% $0.00 $1,815.57 352829 Farm Firestone RADIAL ALL TRACTION 23 420/80R46 $2,881.74 23% $0.00 $2,218.94 352926 Farm Firestone RADIAL ALL TRACTION 23 24.5R32 1*$3,549.54 23% $0.00 $2,733.15 356204 Farm Firestone RADIAL ALL TRACTION 23 30.5LR32 3*$4,186.78 23% $0.00 $3,223.82 362273 Farm Firestone RADIAL ALL TRACTION 23 480/80R46 $2,315.37 23% $0.00 $1,782.83 362324 Farm Firestone RADIAL ALL TRACTION 23 480/80R42 $2,153.87 23% $0.00 $1,658.48 362341 Farm Firestone RADIAL ALL TRACTION 23 480/80R38 $1,742.34 23% $0.00 $1,341.60 362358 Farm Firestone RADIAL ALL TRACTION 23 520/85R42 ZZ $2,466.04 23% $0.00 $1,898.85 362375 Farm Firestone RADIAL ALL TRACTION 23 520/85R38 ZZ $2,152.25 23% $0.00 $1,657.23 362392 Farm Firestone RADIAL ALL TRACTION 23 480/85R34 $1,825.31 23% $0.00 $1,405.49 362800 Farm Firestone RADIAL ALL TRACTION 23 900/60R32 $5,978.54 23% $0.00 $4,603.48 364092 Farm Firestone RADIAL ALL TRACTION 23 480/80R42 $2,509.43 23% $0.00 $1,932.26 372269 Farm Firestone RADIAL ALL TRACTION 23 480/80R46 3*$1,967.85 23% $0.00 $1,515.24 379120 Farm Firestone RADIAL ALL TRACTION 23 420/85R38 $1,833.86 23% $0.00 $1,412.07 Page 26 of 56105 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 379375 Farm Firestone RADIAL ALL TRACTION 23 23.1R26 $3,063.75 23% $0.00 $2,359.09 380395 Farm Firestone RADIAL ALL TRACTION 23 IF520/85R34 $3,309.13 23% $0.00 $2,548.03 000556 Farm Firestone RADIAL ALL TRACTION DT VF750/65R26 $3,905.10 23% $0.00 $3,006.93 000906 Farm Firestone RADIAL ALL TRACTION DT 750/65R26 $3,331.49 23% $0.00 $2,565.25 000907 Farm Firestone RADIAL ALL TRACTION DT 600/70R28 $3,000.00 23% $0.00 $2,310.00 000908 Farm Firestone RADIAL ALL TRACTION DT VF380/95R38 $2,543.53 23% $0.00 $1,958.52 001603 Farm Firestone RADIAL ALL TRACTION DT VF620/75R26 $3,772.44 23% $0.00 $2,904.78 004450 Farm Firestone RADIAL ALL TRACTION DT IF420/90R30 $1,941.00 23% $0.00 $1,494.57 004459 Farm Firestone RADIAL ALL TRACTION DT IF900/75R32CFO $6,874.20 23% $0.00 $5,293.13 004592 Farm Firestone RADIAL ALL TRACTION DT IF710/70R42CFO $5,100.00 23% $0.00 $3,927.00 004927 Farm Firestone RADIAL ALL TRACTION DT VF600/70R28CFO $3,251.88 23% $0.00 $2,503.95 355542 Farm Firestone RADIAL ALL TRACTION DT 710/70R38 $3,999.99 23% $0.00 $3,079.99 355569 Farm Firestone RADIAL ALL TRACTION DT 480/70R30 $2,221.57 23% $0.00 $1,710.61 356271 Farm Firestone RADIAL ALL TRACTION DT 620/70R42 $3,402.37 23% $0.00 $2,619.82 358320 Farm Firestone RADIAL ALL TRACTION DT 710/70R42 $4,960.50 23% $0.00 $3,819.59 358339 Farm Firestone RADIAL ALL TRACTION DT 320/90R54 $2,709.15 23% $0.00 $2,086.05 360155 Farm Firestone RADIAL ALL TRACTION DT 420/85R34 $2,064.54 23% $0.00 $1,589.70 360163 Farm Firestone RADIAL ALL TRACTION DT 600/70R30 $2,280.00 23% $0.00 $1,755.60 360171 Farm Firestone RADIAL ALL TRACTION DT 380/80R38 $1,955.98 23% $0.00 $1,506.10 361925 Farm Firestone RADIAL ALL TRACTION DT 650/75R32 $3,551.20 23% $0.00 $2,734.42 362307 Farm Firestone RADIAL ALL TRACTION DT 600/70R30 $2,395.00 23% $0.00 $1,844.15 362715 Farm Firestone RADIAL ALL TRACTION DT 380/85R24 2*$1,372.85 23% $0.00 $1,057.09 364551 Farm Firestone RADIAL ALL TRACTION DT 380/85R30 $1,345.00 23% $0.00 $1,035.65 364585 Farm Firestone RADIAL ALL TRACTION DT 380/85R34 $1,707.88 23% $0.00 $1,315.07 364602 Farm Firestone RADIAL ALL TRACTION DT 420/90R30 $1,850.25 23% $0.00 $1,424.69 371266 Farm Firestone RADIAL ALL TRACTION DT 600/65R28 $3,040.90 23% $0.00 $2,341.49 372133 Farm Firestone RADIAL ALL TRACTION DT 420/85R34 3*$1,656.72 23% $0.00 $1,275.67 373697 Farm Firestone RADIAL ALL TRACTION DT IF710/70R42 $5,116.01 23% $0.00 $3,939.33 374479 Farm Firestone RADIAL ALL TRACTION DT 620/70R42 $3,500.00 23% $0.00 $2,695.00 374513 Farm Firestone RADIAL ALL TRACTION DT IF420/85R34 $2,289.48 23% $0.00 $1,762.90 375703 Farm Firestone RADIAL ALL TRACTION DT IF600/70R30 $1,871.97 23% $0.00 $1,441.42 375958 Farm Firestone RADIAL ALL TRACTION DT 900/75R32 $6,930.44 23% $0.00 $5,336.44 377539 Farm Firestone RADIAL ALL TRACTION DT IF620/75R30 $2,911.81 23% $0.00 $2,242.09 378219 Farm Firestone RADIAL ALL TRACTION DT IF710/70R38 $3,665.00 23% $0.00 $2,822.05 378542 Farm Firestone RADIAL ALL TRACTION DT IF710/75R42 $5,704.57 23% $0.00 $4,392.52 378627 Farm Firestone RADIAL ALL TRACTION DT IF380/80R38 $2,142.27 23% $0.00 $1,649.55 378882 Farm Firestone RADIAL ALL TRACTION DT IF420/85R38 $2,208.46 23% $0.00 $1,700.51 381585 Farm Firestone RADIAL ALL TRACTION DT IF580/80R34 $3,459.28 23% $0.00 $2,663.65 382469 Farm Firestone RADIAL ALL TRACTION DT 800/65R32 $5,027.63 23% $0.00 $3,871.28 382486 Farm Firestone RADIAL ALL TRACTION DT 650/75R32 $3,600.00 23% $0.00 $2,772.00 340405 Farm Firestone RADIAL ALL TRACTION FWD 16.9R24 2*$1,630.22 23% $0.00 $1,255.27 340421 Farm Firestone RADIAL ALL TRACTION FWD 18.4R26 2*$1,861.56 23% $0.00 $1,433.40 362528 Farm Firestone RADIAL ALL TRACTION FWD 420/85R26 $1,400.00 23% $0.00 $1,078.00 362545 Farm Firestone RADIAL ALL TRACTION FWD 340/85R28 $1,186.53 23% $0.00 $913.63 362562 Farm Firestone RADIAL ALL TRACTION FWD 380/85R28 $1,050.00 23% $0.00 $808.50 362579 Farm Firestone RADIAL ALL TRACTION FWD 420/85R28 $1,433.20 23% $0.00 $1,103.56 362596 Farm Firestone RADIAL ALL TRACTION FWD 380/85R30 $1,250.00 23% $0.00 $962.50 362613 Farm Firestone RADIAL ALL TRACTION FWD 420/90R30 $1,623.45 23% $0.00 $1,250.06 362630 Farm Firestone RADIAL ALL TRACTION FWD 380/85R34 $1,773.21 23% $0.00 $1,365.37 372286 Farm Firestone RADIAL ALL TRACTION FWD 380/85R34 3*$1,377.04 23% $0.00 $1,060.32 379290 Farm Firestone RADIAL ALL TRACTION FWD 380/85R34 $1,876.08 23% $0.00 $1,444.58 000629 Farm Firestone RADIAL ALL TRACTION RC IF380/90R46 $2,558.07 23% $0.00 $1,969.71 000905 Farm Firestone RADIAL ALL TRACTION RC IF380/105R50 $4,233.98 23% $0.00 $3,260.16 005478 Farm Firestone RADIAL ALL TRACTION RC IF380/90R46 $2,173.01 23% $0.00 $1,673.22 380412 Farm Firestone RADIAL ALL TRACTION RC VF380/90R46 $3,455.42 23% $0.00 $2,660.67 380429 Farm Firestone RADIAL ALL TRACTION RC VF380/105R50 $4,657.38 23% $0.00 $3,586.18 000419 Farm Firestone RADIAL ANS IF900/65R32CFO $5,988.60 23% $0.00 $4,611.22 000911 Farm Firestone RADIAL ANS IF800/60R32CFO $4,989.55 23% $0.00 $3,841.95 003170 Farm Firestone RADIAL CHAMP SPADE GRIP IF520/85R42CFO $3,706.31 23% $0.00 $2,853.86 352527 Farm Firestone RADIAL CHAMP SPADE GRIP 16.9R28 ZZ $2,146.73 23% $0.00 $1,652.98 353167 Farm Firestone RADIAL CHAMP SPADE GRIP 20.8R38 2*$2,300.00 23% $0.00 $1,771.00 363004 Farm Firestone RADIAL CHAMP SPADE GRIP 320/90R46 $2,015.60 23% $0.00 $1,552.01 369651 Farm Firestone RADIAL CHAMP SPADE GRIP 520/85R46 $3,459.77 23% $0.00 $2,664.02 369668 Farm Firestone RADIAL CHAMP SPADE GRIP 480/70R34 $2,262.77 23% $0.00 $1,742.33 371198 Farm Firestone RADIAL CHAMP SPADE GRIP 520/85R42 $3,232.91 23% $0.00 $2,489.34 375992 Farm Firestone RADIAL CHAMP SPADE GRIP 900/65R32 $6,343.79 23% $0.00 $4,884.72 000921 Farm Firestone RADIAL DEEP TREAD 23 IF520/85R42CFO $3,941.39 23% $0.00 $3,034.87 000922 Farm Firestone RADIAL DEEP TREAD 23 650/85R38 $4,780.41 23% $0.00 $3,680.92 003144 Farm Firestone RADIAL DEEP TREAD 23 IF800/70R38CFO $7,397.52 23% $0.00 $5,696.09 003148 Farm Firestone RADIAL DEEP TREAD 23 IF580/85R42CFO $4,139.87 23% $0.00 $3,187.70 004451 Farm Firestone RADIAL DEEP TREAD 23 IF480/80R46 $2,650.00 23% $0.00 $2,040.50 004453 Farm Firestone RADIAL DEEP TREAD 23 IF1250/50R32CFO $11,195.88 23% $0.00 $8,620.83 004469 Farm Firestone RADIAL DEEP TREAD 23 IF850/75R42CFO $7,302.86 23% $0.00 $5,623.20 007123 Farm Firestone RADIAL DEEP TREAD 23 VF580/85R42CFO $4,300.00 23% $0.00 $3,311.00 007493 Farm Firestone RADIAL DEEP TREAD 23 VF480/80R50 $4,625.00 23% $0.00 $3,561.25 007494 Farm Firestone RADIAL DEEP TREAD 23 VF480/95R50 $5,350.00 23% $0.00 $4,119.50 359548 Farm Firestone RADIAL DEEP TREAD 23 800/70R38 $5,835.23 23% $0.00 $4,493.13 360090 Farm Firestone RADIAL DEEP TREAD 23 480/80R50 $3,878.37 23% $0.00 $2,986.34 362256 Farm Firestone RADIAL DEEP TREAD 23 480/80R46 $2,546.91 23% $0.00 $1,961.12 362409 Farm Firestone RADIAL DEEP TREAD 23 480/80R42 $2,369.27 23% $0.00 $1,824.34 362426 Farm Firestone RADIAL DEEP TREAD 23 520/85R42 $2,712.64 23% $0.00 $2,088.73 362749 Farm Firestone RADIAL DEEP TREAD 23 480/80R38 $1,916.58 23% $0.00 $1,475.77 362766 Farm Firestone RADIAL DEEP TREAD 23 520/85R38 $2,390.02 23% $0.00 $1,840.32 362851 Farm Firestone RADIAL DEEP TREAD 23 520/85R46 $3,738.31 23% $0.00 $2,878.50 362987 Farm Firestone RADIAL DEEP TREAD 23 650/85R38 $4,615.62 23% $0.00 $3,554.03 364058 Farm Firestone RADIAL DEEP TREAD 23 480/80R42 $2,868.04 23% $0.00 $2,208.39 372150 Farm Firestone RADIAL DEEP TREAD 23 480/80R50 3*$2,859.67 23% $0.00 $2,201.95 374496 Farm Firestone RADIAL DEEP TREAD 23 IF480/80R50 $4,460.13 23% $0.00 $3,434.30 375635 Farm Firestone RADIAL DEEP TREAD 23 IF480/95R50 $5,185.20 23% $0.00 $3,992.60 378610 Farm Firestone RADIAL DEEP TREAD 23 IF520/85R46 $4,260.71 23% $0.00 $3,280.75 378746 Farm Firestone RADIAL DEEP TREAD 23 IF800/70R38 $6,710.50 23% $0.00 $5,167.09 380446 Farm Firestone RADIAL DEEP TREAD 23 IF1250/50R32CFO $11,961.22 23% $0.00 $9,210.14 381823 Farm Firestone RADIAL DEEP TREAD 23 520/85R42 $3,420.57 23% $0.00 $2,633.84 382452 Farm Firestone RADIAL DEEP TREAD 23 580/85R42 $3,449.89 23% $0.00 $2,656.42 318523 Farm Firestone RIB DUPLEX FARM 36X16-17.5 8 $770.00 23% $0.00 $592.90 361968 Farm Firestone RIB DUPLEX FARM 36X16-17.5 14 $1,117.00 23% $0.00 $860.09 324221 Farm Firestone RIB IMPLEMENT 11.25-24 8 $496.00 23% $0.00 $381.92 326453 Farm Firestone RIB IMPLEMENT 11.25-28 12 $864.00 23% $0.00 $665.28 355518 Farm Firestone RIB IMPLEMENT 31X13.50-15 8 $301.00 23% $0.00 $231.77 355534 Farm Firestone RIB IMPLEMENT 11.25-24 12 $609.00 23% $0.00 $468.93 356212 Farm Firestone RIB IMPLEMENT 9.00-24 8 $410.00 23% $0.00 $315.70 358622 Farm Firestone RIB IMPLEMENT HF 31X13.50-15 12 $332.00 23% $0.00 $255.64 365061 Farm Firestone SUPER ALL TRACTION II 23 14.9-24 6 $475.99 23% $0.00 $366.51 Page 27 of 56106 of 549 Material Number TIRE TYPE BRAND TIRE PATTERN SIZE PLY 1/1/2018 CATALOG PRICE Discount % FET Approved PRICES Non-Contract State Price List 365078 Farm Firestone SUPER ALL TRACTION II 23 14.9-28 6 $515.66 23% $0.00 $397.06 365180 Farm Firestone SUPER ALL TRACTION II 23 11.2-24 8 $293.98 23% $0.00 $226.36 365265 Farm Firestone SUPER ALL TRACTION II 23 13.6-28 6 $483.34 23% $0.00 $372.17 365282 Farm Firestone SUPER ALL TRACTION II 23 16.9-30 6 $617.67 23% $0.00 $475.61 365299 Farm Firestone SUPER ALL TRACTION II 23 12.4-24 4 $400.49 23% $0.00 $308.38 365452 Farm Firestone SUPER ALL TRACTION II 23 12.4-28 6 $454.48 23% $0.00 $349.95 365469 Farm Firestone SUPER ALL TRACTION II 23 16.9-28 6 $602.43 23% $0.00 $463.87 367237 Farm Firestone SUPER ALL TRACTION II 23 20.8-38 8 $1,214.40 23% $0.00 $935.09 371351 Farm Firestone SUPER ALL TRACTION II 23 9.5-24 6 $258.04 23% $0.00 $198.69 372507 Farm Firestone SUPER ALL TRACTION II 23 18.4-38 8 $867.17 23% $0.00 $667.72 372524 Farm Firestone SUPER ALL TRACTION II 23 15.5-38 8 $744.40 23% $0.00 $573.19 372541 Farm Firestone SUPER ALL TRACTION II 23 12.4-24 8 $359.66 23% $0.00 $276.94 372575 Farm Firestone SUPER ALL TRACTION II 23 13.6-24 8 $402.76 23% $0.00 $310.13 372592 Farm Firestone SUPER ALL TRACTION II 23 18.4-34 8 $802.82 23% $0.00 $618.17 372626 Farm Firestone SUPER ALL TRACTION II 23 18.4-30 8 $745.45 23% $0.00 $574.00 373238 Farm Firestone SUPER ALL TRACTION II 23 14.9-24 8 $459.92 23% $0.00 $354.14 376808 Farm Firestone SUPER ALL TRACTION II 23 9.5-16 4 $212.73 23% $0.00 $163.80 343560 Farm Firestone SUPER ALL TRACTN 23 18.4-34 8 $971.99 23% $0.00 $748.43 343579 Farm Firestone SUPER ALL TRACTN 23 20.8-34 8 $1,483.63 23% $0.00 $1,142.40 343587 Farm Firestone SUPER ALL TRACTN 23 16.9-38 8 $1,307.63 23% $0.00 $1,006.88 343595 Farm Firestone SUPER ALL TRACTN 23 18.4-38 8 $1,126.63 23% $0.00 $867.51 343609 Farm Firestone SUPER ALL TRACTN 23 20.8-38 8 $1,365.60 23% $0.00 $1,051.51 343633 Farm Firestone SUPER ALL TRACTN 23 20.8-38 10 $1,685.92 23% $0.00 $1,298.16 344060 Farm Firestone SUPER ALL TRACTN 23 28L-26 12 $2,069.61 23% $0.00 $1,593.60 344079 Farm Firestone SUPER ALL TRACTN 23 24.5-32 12 $2,053.14 23% $0.00 $1,580.92 344095 Farm Firestone SUPER ALL TRACTN 23 23.1-26 8 $1,835.78 23% $0.00 $1,413.55 344109 Farm Firestone SUPER ALL TRACTN 23 23.1-34 8 $1,890.36 23% $0.00 $1,455.58 351067 Farm Firestone SUPER ALL TRACTN 23 30.5L-32 14 $2,742.18 23% $0.00 $2,111.48 351075 Farm Firestone SUPER ALL TRACTN 23 30.5L-32 16 $3,479.61 23% $0.00 $2,679.30 362460 Farm Firestone SUPER ALL TRACTN 23 23.1-26 14 $1,956.56 23% $0.00 $1,506.55 343846 Farm Firestone SUPER ALL TRACTN FWD 18.4-26 6 $1,093.53 23% $0.00 $842.02 343919 Farm Firestone SUPER ALL TRACTN FWD 18.4-26 10 $1,431.38 23% $0.00 $1,102.16 343927 Farm Firestone SUPER ALL TRACTN FWD 13.6-28 10 $854.99 23% $0.00 $658.34 343943 Farm Firestone SUPER ALL TRACTN FWD 16.9-28 10 $1,092.78 23% $0.00 $841.44 363038 Farm Firestone SUPER ALL TRACTN HD 520/85D38 $2,572.59 23% $0.00 $1,980.89 350672 Farm Firestone SUPER TRACTION LOADER 27X8.50-15 6 $182.73 23% $0.00 $140.70 338087 Farm Firestone TRACTION FIELD & ROAD 13.6-38 6 $758.00 23% $0.00 $583.66 338494 Farm Firestone TRACTION FIELD & ROAD 18.4-28 6 $1,187.57 23% $0.00 $914.43 338516 Farm Firestone TRACTION FIELD & ROAD 14.9-38 6 $958.20 23% $0.00 $737.81 338613 Farm Firestone TRACTION FIELD & ROAD 23.1-30 8 $1,844.90 23% $0.00 $1,420.57 345202 Farm Firestone TRACTION FIELD & ROAD 12.4-16 4 $436.96 23% $0.00 $336.46 345288 Farm Firestone TRACTION FIELD & ROAD 14.9-26 6 $750.42 23% $0.00 $577.82 345334 Farm Firestone TRACTION FIELD & ROAD 14.9-24 6 $547.18 23% $0.00 $421.33 351725 Farm Firestone TRACTION FIELD & ROAD 11.2-24 6 $375.04 23% $0.00 $288.78 355097 Farm Firestone TRACTION FIELD & ROAD 12.4-42 6 $841.94 23% $0.00 $648.29 355119 Farm Firestone TRACTION FIELD & ROAD 16.9-26 6 $1,112.16 23% $0.00 $856.36 357987 Farm Firestone TRACTION FIELD & ROAD 12.4-24 12 $769.95 23% $0.00 $592.86 358630 Farm Firestone TRACTION FIELD & ROAD 12.4-42 10 $962.17 23% $0.00 $740.87 359505 Farm Firestone TRACTION FIELD & ROAD 16.9-24 8 $839.90 23% $0.00 $646.72 359564 Farm Firestone TRACTION FIELD & ROAD 18.4-16.1 8 $1,019.96 23% $0.00 $785.37 364857 Farm Firestone TRACTION FIELD & ROAD 23.1-30 12 $1,857.43 23% $0.00 $1,430.22 312770 Farm Firestone TURF & FIELD 21.5L-16.1 6 $808.38 23% $0.00 $622.45 351776 Farm Firestone TURF & FIELD 9.5-16 6 $338.33 23% $0.00 $260.51 354856 Farm Firestone TURF & FIELD 31X13.50-15 8 $313.00 23% $0.00 $241.01 355887 Farm Firestone TURF & FIELD 21.5L-16.1 10 $1,207.54 23% $0.00 $929.81 356190 Farm Firestone TURF & FIELD 19.5L-24 10 $1,314.82 23% $0.00 $1,012.41 359785 Farm Firestone TURF & FIELD 29X12.00-15 6 $261.00 23% $0.00 $200.97 345210 Farm Firestone TURF & FIELD 7-RIB 13.6-16 4 $405.89 23% $0.00 $312.54 362190 Farm Firestone TURF&FIELD STUBBLE STOMPE 31X13.50-15 10 $433.00 23% $0.00 $333.41 Page 28 of 56107 of 549 To:Bridgestone Authorized Dealers and Stores Date: Subject: This is your approval to sell Bridgestone and/or Firestone tires on the following basis to the above subject customer. This approval applies only to the Bridgestone and/or Firestone products that you are authorized to purchase. Products are subject to availability and may be discontinued at any time and without notice. 1/1/2018 - 12/31/2018 Approved pricing (including any net priced items) for this approval can be found at www.batogovtires.com as an attachment under “Contracts”. Please be advised that pricing is subject to change at any time and notification will be sent when changes are made. New items may also be added during the duration of the approval. Please call our helpdesk at (866) 936-7468 for pricing requests or assistance with downloading a price list. Approved net pricing list is attached. The following discounts have been approved for the term period. Please reference the January 1, 2018 Bridgestone Confidential Government Catalog less the following discounts (Same discount will apply to new tires added since the establishment of the Bridgestone Confidential Government Price List): 20%20% 20%20% 43%40% 37%37% 23% As a Bridgestone authorized distributor, there will be no credit issued for delivered units or commission issued for billing (DR, TST, BFDI) submitted 30 days or more after the delivery date. For billing inquiries, please call (888) 709-8023 or email billingservices@bfusa.com . If you have questions on who qualifies for pricing under this approval, please contact your Bridgestone sales representative for the Bridgestone and/or Firestone products that you are authorized to purchase. Contact information is also located on www.batogovtires.com should you have any other questions. Best regards, Vicky Dunbar – Manager of Government Sales CC: Billing Services All in IL December 18, 2017 Bridgestone Americas Tire Operations, LLC Government Sales Department 200 4th Avenue South Nashville, TN 37201 7129 State of Illinois - Non Contract - Including all Cities, Counties, and Schools The period of approval is Bridgestone brand Firestone Brand All passenger tires All passenger tires All farm tires All light truck tires All light truck tires All medium truck tires All medium truck tires All OTR tires All OTR tires Page 1 of 1108 of 549 For City Council meeting of February 12, 2018 Item A3.3 Business of the City by Motion: Tire Repair Services Contract Renewal For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Kimberly Richardson, Interim Director of Administrative Services Sean Ciolek, Manager of Facilities & Fleet David Waite, Fleet Supervisor Lisa Gray, Fleet Operations Coordinator Subject: 2nd Year Optional Renewal for Tire Repair Services Date: January 19, 2018 Recommended Action: Staff recommends City Council approval for the City Manager to authorize a one (1) year renewal for tire repair and recap services in the amount of $24,672 with Wentworth Tire Service (300 North York Road, Bensenville, IL). This will be the second (2nd) and final renewal on this contract from January 1, 2018 through December 31, 2018. Funding Source: FY 2018 Tires and Tubes Account Account 600.19.7710.65065 $100,000.00 The $24,672 represents 24.7% of this budgeted amount. Livability Benefit: Innovation & Process: Support local government best practices and processes Summary: In April 2016, staff solicited bids for tire mounting, dismounting, and recapping services from qualified vendors. The agreement was for a one (1) year period with the right to extend the agreement for up to two (2) one-year periods. This will be the second (2nd) year request for renewal. Wentworth Tire Service was the successful bidder with the lowest bid price. Bids were advertised with a due date of May 17, 2016. Bids were received as follows: Company Name City/State Description Bid Amount Wentworth Tire Service Bensenville, IL Tire Services $24,672.00 Pomps Tire Service Elk Grove Village, IL Tire Services $28,127.75 Tredroc Tire Elk Grove Village, IL Tire Services Non-responsive Cassidy Tire Addison, IL Tire Services Non-responsive Wingfoot Commercial Elk Grove Village, IL Tire Services Non-responsive Memorandum 109 of 549 Tire Duxler Tire Evanston, IL Tire Services Non-responsive Based on Bid # 16-41 results, staff recommended approval of the award to Wentworth Tire Service as the lowest responsive and responsible bidder to provide tire repair services for the City and it was approved. Wentworth Tire has been a responsive and responsible vendor for the past few years. There are no Evanston-based tire service vendors who can meet all of our fleet needs at this time. Prior to releasing the original bid document, staff had contacted several Evanston- based firms and made inquiries as to their ability to participate in the bid process to provide these services. The following is a list of firms contacted and their responses. Date of Contact Evanston Business Reason/Explanation 3/8/2016 Duxler Tires Cannot purchase as low as State bid 3/8/2016 Doc Ables Auto Clinic & Tire Could not match State bid price 3/9/2016 Jakes Auto & Tire Service One person operation and could not provide service required nor did not know about State bid 3/9/2016 Midas Cannot purchase off of State bid Each year staff reaches out to the Evanston vendors again to confirm they are not able to provide the product as requested. 110 of 549 For City Council meeting of February 12, 2018 Item A3.4 Business of the City by Motion: Contract Renewal – Fire Apparatus/Devices For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Erika Storlie, Manager Administrative Services Sean Ciolek, Manager Fleet and Facilities Lisa Gray, Fleet Operations Coordinator David W aite, Fleet Supervisor Subject: One-Year Contract Renewal for Testing, Repair & Certification of Fire Apparatus and Aerial Devices Date: January 19, 2018 Recommended Action: Staff recommends City Council approval of a one year contract extension (RFP 15-30) to Global Emergency Products (1401 N. Farnsworth Avenue, Aurora, IL 60505) in the amount of $72,300.00, to provide the required annual inspections and repairs for heavy fire apparatus vehicles assigned to Evanston Fire Department. This will be the third and final renewal. There is no cost increase from the last renewal. Livability Benefit: Health & Safety: Improve emergency prevention and response Funding Source: FY2018 Budget 600.19.7710.65060 $1,050,000.00 FY2018 Request $72,300.00 Summary: RFP 15-30 was originally created on March 26, 2015, and received City Council Approval on May 11, 2015. The contract approval contains provisions for three (3) 1- year extensions in each successive fiscal year; 2016, 2017 and 2018. The original contract effective date is May 11, 2015. This renewal is to cover January 1, 2018 through December 31, 2018 Legislative History: Approval of Original Contract Attachment: Professional Services Agreement from 2015 Memorandum 111 of 549 112 of 549 113 of 549 114 of 549 115 of 549 116 of 549 117 of 549 118 of 549 119 of 549 120 of 549 121 of 549 122 of 549 123 of 549 For City Council meeting of February 12, 2018 Item A3.5 Business of the City by Motion: Howard Street Theatre Construction Services Contract Award For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Lara Biggs, P.E., Bureau Chief – Capital Planning / City Engineer Stefanie Levine, Senior Project Manager Subject: Howard Street Theatre Construction Services Contract Award (Bid 17-60) Date: February 12, 2018 Recommended Action: Staff recommends that City Council authorize the City Manager to execute a contract to provide construction services for the Howard Street Theatre with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, Illinois 60647) in the amount of $1,385,469.00. Funding Source: Funding for this project will be provided from Capital Improvement Program (CIP) Howard-Ridge TIF funds (Account 415.40.4218.65515 – 617016), which has an FY 2018 budget allocation of $1,756,058. The Howard Ridge TIF will issue debt and will pay the debt service costs for the architectural and construction costs for this project. Livability Benefits: Built Environment: Enhance public spaces Education Arts & Community: Incorporate art and cultural resources Background: Over the past ten months, the City has worked with future tenants, Theo Ubique, and Ross Barney Architects to develop renovation design documents for the property at 721 Howard Street to convert this vacant storefront into a dinner theater. Construction documents for this project were finalized in the fall of 2017. Analysis: On December 21, 2017 the City issued bid documents for the project and on January 25, 2018 the City received and publicly read eleven (11) bids. In addition to public advertising the bid in the Chicago Tribune, project bid documents were sent directly to forty-four (44) prospective contractors. Bid results were as follows: Memorandum 124 of 549 Firm Address Base Bid Alternate 1 Alternate 2 Alternate 3 Structures Construction LLC 2300 W. Diversey Ave, Chicago, IL $1,385,469.00 $12,870.00 $8,840.00 $10,400.00 Reliable & Assoc. Construction Co. 4106 S. Emerald Ave, Chicago, IL $1,538,880.00 $14,000.00 $9,800.00 $16,500.00 FBG Corporation 1015 S. Rt 83, Elmhurst, IL $1,634,000.00 $4,000.00 $3,500.00 $4,600.00 Integral Construction Inc. 320 Rocbaar Dr., Romeoville, IL $1,653,200.00 $19,000.00 $5,000.00 $9,500.00 G.A. Johnson & Son 828 Foster St., Evanston, IL $1,764,869.00 $4,500.00 $8,900.00 $9,300.00 Boller Construction Co. Inc. 3045 Washington St., Waukegan, IL $1,769,000.00 -$15,000.00 $28,000.00 $6,200.00 F.H. Paschen, S.N. Nielsen & Assoc., LLC 5515 N. East River Road, Chicago, IL 60656 $1,771,000.00 $27,000.00 $7,300.00 $9,000.00 Tower Contracting LLC 9500 Bormet Dr., Mokena, IL $1,934,000.00 $3,500.00 $2,500.00 $10,400.00 D. Kersey Construction Co. 4130 Timberlane Dr., Northbrook IL $1,945,833.00 $18,985.00 $3,300.00 $10,500.00 James McHugh Construction Co. 1737 S. Michigan Ave., Chicago, IL $1,955,000.00 $500.00 $7,500.00 $0.00 Kandu Construction Inc. 3756 W. Devon, Lincolnwood, IL $2,117,000.00 $8,600.00 $7,650.00 $12,800.00 Bid documents included three alternate items as follows: 1. Alternate 1 – install high density fiber cement board along the building’s south façade in lieu of medium density fiber cement board. This item is not recommended for award due to cost. 2. Alternate 2 – install additional shelving behind the proposed bar area. This item is not recommended for award due to cost. 3. Alternate 3 – mill and resurface the parking area behind the building in lieu of asphalt patching. This item is not recommended for award due to cost. Structures Construction meets the City’s M/W/EBE goals and has indicated they are willing to work with the City to achieve LEP compliance (see attached memo for more information). The City’s consultant contacted references which indicate that Structures 125 of 549 Construction has performed a variety of similar improvement projects with successful results. Staff therefore recommends that the base bid plus be awarded to Structures Construction, for a total amount of $1,385,469.00. Legislative History: On 5/11/15, City Council adopted resolution 45-R-15 authorizing the City Manager to initiate a Request for Proposal process for a theater to lease City-owned property on Howard Street. This process identified Strawdog Theater Company as the preferred tenant, with Theo Ubique as a first runner-up. On 9/21/15, City Council authorized the City Manager to engage in an RFP process for architecture/design services for an amount up to $40,000. This process ultimately led to a contract award to Ross-Barney Architects for initial design work for the Howard Street Theater. On 11/9/15, City Council adopted resolution 102-R-15, authorizing the City Manager to execute a Memorandum of Understanding with Strawdog Theatre Company for the development and lease of two City-owned parcels at 717 Howard Street and 721-723 Howard Street. On 11/28/16, the City Council adopted resolution 71-R-16, directing the City Manager to negotiate and execute a Memorandum of Understanding (MOU) with Theo Ubique. On 03/13/17 the City Council approved architectural services for this project to Ross Barney Architects Attachments: M/W/EBE Compliance Review Memo, dated 02/12/18 126 of 549 Bid 17-60, Howard Street Theatre Construction Services, M/W/EBE Memo, 02.12.2018 To: David Stoneback, Public Work Agency Director Lara Biggs, Bureau Chief – Capital Planning / City Engineer Stefanie Levine, Senior Project Manager From: Tammi Nunez, Purchasing Manager Subject: Howard Street Theatre Construction Services, Bid 17-60 Date: February 12, 2018 The goal of the Minority, Women and Evanston Business Enterprise Program (M/W/EBE) is to assist such businesses with opportunities to grow. In order to help ensure such growth, the City’s goal is to have general contractors utilize M/W/EBEs to perform no less than 25% of the awarded contract. With regard to the recommendation for the Howard Street Theatre Construction Services project, Bid 17-60, Structures Construction’s total base bid is $1,385,469.00, and they will receive 26.1% credit for compliance towards the M/W/EBE goal. Name of M/W/EBE Scope of Work Contract Amount % MBE WBE EBE Windy City Heating & Cooling 3416 W. Division Street Melrose Park, IL 60160 HVAC $216,925.00 15.6% X Evergreen Supply Company 312 N. May Street, Unit 104 Chicago, IL 60607 Construction Materials $100,000.00 7.2% X Kedmont Waterproofing Co. 5428 North Kedzie Chicago, IL 60661 Roofing Contractors $11,212.50 .8% X Central Rug & Flooring 3006 Central Street Evanston, IL 60201 Flooring $35,750.00 2.5% X Total M/W/EBE $363,887.50 26.1% CC: Ashley King, Interim Chief Financial Officer / City Treasurer Memorandum 127 of 549 For City Council meeting of February 12, 2018 Item A3.6 Business of the City by Motion: West Filter Plant Study (RFP 17-58) For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David Stoneback, Public Works Agency Director Lara Biggs, Bureau Chief – Capital Planning / City Engineer Paul Moyano, Senior Project Manager Subject: West Filter Plant Study (RFP 17-58) Date: January 30, 2018 Recommended Action: Staff recommends City Council authorize the City Manager to execute a contract for the West Filter Plant Study (RFP 17-58) with Carollo Engineers, Inc. (8600 W. Bryn Mawr Avenue, Suite 900N, Chicago, IL 60631) in the amount of $126,033.00. Funding Source: Funding for the study will be provided from the Water Fund (Account 510.40.4200.62180). This project was budgeted at $150,000.00 in FY 2018. Livability Benefits: Built Environment: Manage water resources responsibly Reduce Environmental Impact: Improve energy and water efficiency Health & Safety: Enhance resiliency to natural & human hazards Background: The Water Filtration Plant is comprised of two main sets of filters that were built in 4 phases and are integral to the building structures that house them. The oldest set of filters is housed at the West Filter Plant, which was built in two phases in 1914 and 1923. While the filters have generally been maintained in good working condition, many of the components are becoming more difficult to maintain as they age and are nearing the end of their useful life. In addition, both the masonry and the roofing system of the superstructure are in need of significant repair. The decision of how to best address the needs of the West Filter Plant, while balancing the requirements for overall filtration capacity of the water plant, reliability/redundancy, maintenance/operation, historic preservation of the building, and state regulations is complicated. Because different choices require different infrastructure improvements, Memorandum 128 of 549 staff is recommending that a study be completed that considers long-term costs as well as benefits. The final decision will consider these issues incorporating a lifecycle cost analysis to provide the best and most cost-effective long-term approach to the needs of the City’s water filtration plant. Summary: On November 2, 2017 staff issued a Request for Proposal for professional engineering services for the West Filter Plant Study. This project was advertised in the Pioneer Press and on Demandstar. On December 19, 2017 the City received five proposals as follows: Firm Address Total Cost CDM Smith, Inc. 125 South Wacker Drive, Suite 700, Chicago, IL 60606 $110,539 Carollo Engineers, Inc. 8600 W. Bryn Mawr Avenue, Suite 900N, Chicago, IL 60631 $126,033 Crawford, Murphy & Tilly, Inc. 550 N. Commons Drive, Suite 116, Aurora, IL 60504 $143,855 GHD Services Inc. 6400 Shafer Court, Suite 400, Rosemont, IL 60018 $150,000 Black & Veatch Corporation Two North Riverside Plaza, Suite 2050, Chicago, IL 60606 $158,794 Proposals were reviewed by the following staff: • Darrell King, Bureau Chief – Water Production • Lara Biggs, Bureau Chief – Engineering and Capital Planning • Kevin Zeoli, Division Chief – Filtration • Jay Henderson, Division Chief – Pumping • Paul Moyano, Senior Project Manager • Jill Ostman, Purchasing Specialist The scoring of the proposals is shown on the following table. 129 of 549 Selection Criteria Max Pts Carollo Engineers, Inc. CDM Smith, Inc. Crawford, Murphy & Tilly, Inc. Black & Veatch Corporation GHD Services Inc. Firm Qualifications and Experience 15 14 14 10 14 11 Project Team Qualifications and Experience 20 17 18 15 14 12 Project Approach 15 15 11 12 12 12 Cost / Level of Effort 20 19 20 17 14 16 Willingness to Execute Agreement 10 10 10 10 9 9 Organization and Completeness of Proposal 10 10 10 9 9 10 M/W/EBE Participation 10 10 10 10 10 10 Totals 100 95 93 83 82 80 Carollo Engineers received the overall highest score. They demonstrated a good overall understanding of the project and developed a detailed project approach, while providing a highly-qualified team. Staff has worked with them on previous projects and found their work to be satisfactory. Carollo is proposing to comply with the 25.3% MBE participation goal. A memo reviewing compliance with the City’s M/W/EBE program is attached. Attachments: M/W/EBE Memo 130 of 549 RFP 17-58, West Filter Plant Study, M/W/EBE Memo, 02.12.2018 To: David Stoneback, Public Work Agency Director Lara Biggs, Bureau Chief – Capital Planning / City Engineer Paul Moyano, Senior Project Manager From: Tammi Nunez, Purchasing Manager Subject: West Filter Plant Study, RFP 17-58 Date: February 12, 2018 The goal of the Minority, Women and Evanston Business Enterprise Program (M/W/EBE) is to assist such businesses with opportunities to grow. In order to help ensure such growth, the City’s goal is to have general contractors utilize M/W/EBEs to perform no less than 25% of the awarded contract. With regard to the recommendation for the West Filter Plant Study, RFP 17-58, Carollo Engineers total base bid is $126,033.00, and they will receive 25.3% credit for compliance towards the M/W/EBE goal. Name of M/W/EBE Scope of Work Contract Amount % MBE WBE EBE Environmental Design International 33 W. Monroe Str. Ste. 1825 Chicago, IL 60603 Engineering Services $11,470.00 9.1% X McGuire Igleski & Associates 1330 Sherman Ave Evanston, IL 60201 Architectural Services $20,400.00 16.2% X Total M/W/EBE $31,870.00 25.3% CC: Ashley King, Interim Chief Financial Officer / City Treasurer Memorandum 131 of 549 To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David D. Stoneback, Public Works Agency Director Darrell A. King, Water Production Bureau Chief Subject: Renewal of the Annual Harris Maintenance and Support Agreement Date: February 12, 2018 Recommended Action: Staff recommends that City Council authorize the City Manager to execute a renewal of the annual sole source maintenance and support agreement for the term March 1, 2018 through February 28, 2019 with Harris Computer Systems (1 Antares Drive, Suite 400, Ottawa, Ontario) for Harris NorthStar Utility Billing software, in the amount of $41,289.90. Funding Source: Funding for this purchase will be from Account 510.40.4225.62340 which has an allocation of $45,000.00. This account has a YTD balance of $183,200.00. Livability Benefits: Built Environment: Manage water resources responsibly Summary: The Harris NorthStar Utility Billing Software (known in Evanston as AQUAS) is a utility billing system that has been used by the Public Works Agency since 2009. The AQUAS system is used for billing customers for water, sewer and sanitation charges. Annual maintenance and support agreements are standard in the technology industry and are typically assessed by software companies to continuously improve software applications as well as to fund support centers with skilled employees for customers in order to resolve problems as quickly as possible. The City, as a customer with an active maintenance and support agreement, has access to all available fixes and enhancements to the software as well as access to online and telephone customer support. Memorandum For City Council meeting of February 12, 2018 Item A3.7 Business of the City by Motion: Renewal of Annual Harris Maintenance and Support Agreement For Action 132 of 549 This is a sole-source request because the only option for continuous comprehensive maintenance and support of the Harris NorthStar application is Harris Computer Systems as the developer and distributor of the software. There are no independent third-party businesses that provide support for this product. The table below provides a historical maintenance and support cost summary beginning 2009 through 2017. Fiscal Year Required Funding Percent Change from Previous Year 2018 $41,289.90 2% 2017 $40,480.31 3% 2016 $39,301.27 *-9.82% 2015 $43,578.96 3% 2014 $42,276.57 8.15% 2013 $39,090.68 4.99% 2012 $37,229.22 4.99% 2011 $35,456.40 5% 2010 $33,768.00 5% 2009 $32,160.00 - *The decrease in cost between 2015 & 2016 is attributable to the removal of mCare due to its incompatibility with the City Works software previously used for creating work orders. History: Approved on consent agenda during the Administration & Public Works Committee meeting on February 13, 2017. Alternatives: Currently, there are no practical alternatives to this renewal. 133 of 549 For City Council meeting of February 12, 2018 Item A3.8 Business of the City by Motion: 2018 Sewer Flow Monitoring For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David Stoneback, Public Works Agency Director Lara Biggs, Bureau Chief – Capital Planning / City Engineer Paul Moyano, Senior Project Manager Subject: 2018 Sewer Flow Monitoring (Bid No. 18-03) Award of Contract Date: January 23, 2018 Recommended Action: Staff recommends that City Council authorize the City Manager to execute a contract for the 2018 Sewer Flow Monitoring (Bid No. 18-03) with ADS Environmental Services (ADS) (340 The Bridge Street, Suite 204, Huntsville, AL 35806) in the amount of $38,000. Funding Source: Funding for this project is from the Sewer Fund, Account 515.40.4531.62180, which has an FY 2018 budget of $75,000. Livability Benefits: Built Environment: Manage water resources responsibly Sustainability: Enhance resiliency to natural and human hazards Background: The City of Evanston is working toward developing a city-wide combined sewer hydraulic model to use as a tool in analyzing sewer system performance, identifying problem areas, and evaluating potential solutions to sewer system issues. As a first step, the City is preparing a hydraulic model for Basin B06, one of the City’s fifteen combined sewer drainage basins which is located in the north-west corner of the City. This contract includes the installation, calibration, maintenance, and data collection from ten sewer flow meters in local sewers and two rain gauges to be located in Basin B06. A project location map is attached. Meters and gauges will be installed for a minimum 90 Memorandum 134 of 549 day metering period between April 1, 2018 and August 1, 2018. The proposed project will provide calibration data for the City’s hydraulic model. Discussion: Bids for the subject project were opened and publicly read on Tuesday, January 16, 2018. Two contractors submitted bids for this project as summarized in the table below. The bid tabulation is attached for reference. Contractor Address Total Bid ADS Environmental Services 340 The Bridge Street, Suite 204, Huntsville, AL 35806 $38,000 RJN Group 200 West Front Street, Wheaton, IL 60187 $56,200 The submitted bids cannot be withdrawn or canceled for a period of sixty (60) calendar days following the bid opening, or until March 17, 2018. The bids were reviewed by Bridget Nash, Civil Engineer II, and Paul Moyano, Senior Project Manager. ADS is the lowest responsible bidder meeting the project specifications. ADS is requesting a full waiver of the City’s M/W/EBE program goal since no subcontracting opportunities exist due to the technical nature of the project. A review of ADS’s compliance with the City’s M/W/EBE goals is attached. Staff recommends award to ADS. ADS has over 40 years of experience in wastewater collection system evaluation and has performed similar work for the City of Chicago and for municipalities throughout Illinois and the nation. Near the end of the initial 90-day flow monitoring period, data will be reviewed by City staff. If rainfall was not sufficient to produce adequate sewer flow data during this period, the City may negotiate a change order with the ADS to extend the flow monitoring period within the budget established for this work. If the Change Order is needed, it would be presented to City Council for approval. Legislative History: None Attachments: 2018 Sewer Flow Monitoring Location Map Bid Tabulation for Bid 18-03 2018 Sewer Flow Monitoring M/W/EBE Compliance Review, dated February 12, 2018 135 of 549 !\!\ !\ !\ !\ !\ !\ !\ !\ !\ !\NORTH SHORE CHANNEL6 1 2 34 5 9 10 7 8 Proposed RainGauge Location2530 Gross Point Rd HARTREY AVESIMPSON ST PAYNE ST COLFAX ST PARK PL ST E W A R T A V E PAYNE ST CENTRAL STHIGHLAND AVEISABELLA ST L I N C O L N ST GRANT ST BENNETTAVEHARRISON ST SIMPSON ST CENTRAL ST HILLSIDE RDHURD AVESIMPSON ST PARK PL HARRISON ST FORESTVIEW RDPARK PL THAYER ST GROSSPOINTRDGLENVIEW R D LINCOLNWOOD DRELGI N RD NOYES STLINCOLNWOODDRPRINCETON AVEMCDANIELAVELYONS STPROSPECT AVEHARRISON ST E LM A V EPROSPECT AVELINCOLN ST NOYES ST PARK PL WALNUT AVETH A Y E R ST HARTZELL ST THAYER ST WALNUT AVEBENNETT AVEJENKSSTEWING AVEREESE AVEMARCY AVEEWING AVEFOSTERSTCULVER ST HAYES ST PAYNE ST NOYES ST PARK PL PARK PL THAYER ST MARTHA LNCOWPERAVEHASTINGSAVEMARCYAVELAWNDALEAVERIDGEWAYAVEMCDANIELAVENORMANDY PL HURD AVELAUREL AVEKNOXCIRTHAYER ST ELM AVELEMAR AVEHARTREY AVECENTRALPARKAVECRAWFORDAVEBENNETT AVEPIONEERRDPIONEER RDLELAND AVEPROSPECTAVEMCDANIEL AVELINCOLNWOOD DRGREELEY AVE!\Proposed Flowmeter Location Main Road Local Street Railroad Water Basin B06 Boundary 0 500 1,000250 Feet 1:12,000 1 inch = 1,000 feet City of Evanston2018 Sewer Flow MonitoringBid # 18-03 12/01/2017 This map is provided "as is" without warranties of any kind. See www.cityofevanston.org/mapdisclaimers.html for more information. Flowmeters_BWltr.mxd ´ 136 of 549 1 Flow Meter 1 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.002 Flow Meter 2 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.003 Flow Meter 3 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.004 Flow Meter 4 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.005 Flow Meter 5 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.006 Flow Meter 6 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.007 Flow Meter 7 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.008 Flow Meter 8 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.009 Flow Meter 9 EA1 $6,825.00 $6,825.00 $3,600.00 $3,600.00 $5,500.00 $5,500.0010 Flow Meter 10 EA1 $6,258.00 $6,258.00 $3,600.00 $3,600.00 $5,500.00 $5,500.0011 Rain Gauge EA2 $600.00 $1,200.00 $1,000.00 $2,000.00 $600.00 $1,200.00$68,883.00$38,000.00$56,200.00$38,000.00$56,200.00APPROVED ENGINEER'S ESTIMATEADSCITY OF EVANSTONTABULATION OF BIDS FORUNIT PRICE TOTAL UNIT PRICEHuntsville, AL 35806340 The Bridge Street, Ste 2042018 SEWER FLOW MONITORING - BID NO. 18-03BIDDERSDATE: January 16, 2018 TIME: 2:00 PM ATTENDED BY: Bridget NashTOTALTOTAL BIDAS READAS CORRECTEDRJN Group200 West Front StreetWheaton, IL 60187UNIT PRICE TOTALITEM NO.ITEM UNITTOTAL QUANTITY137 of 549 2018 Sewer Flow Monitoring, Bid 18-03, M/W/EBE Memo 02.12.2018 To: David Stoneback, Public Works Agency Director Lara Biggs, P.E. Bureau Chief – Capital Planning / City Engineer Paul Moyano, Senior Project Manager From: Tammi Nunez, Purchasing Manager Subject: 2018 Sewer Flow Monitoring, Bid 18-03 Date: February 12, 2018 The goal of the Minority, Women, and Evanston Business Enterprise Program (M/W/EBE) is to assist such businesses with opportunities to grow. In order to help ensure such growth, the City has established a 25% M/W/EBE subcontracting participation goal for general contractors. However, the 2018 Sewer Flow Monitoring, Bid 18-03, precludes subcontracting opportunities. ADS Environmental Services has requested a full waiver for the MWEBE participation goal. Due to the technical nature of this project, it is not feasible to utilize a subcontractor who is not trained in ADS equipment. Because of the high quality and complex technical nature of the equipment components used for this work especially for temporary flow studies, ADS certified and trained crews are responsible for caring for those components such as sensors, batteries, circuit boards, and additional flow monitoring parts used specially for ADS flow monitors. ADS is not aware nor has record of any local M/W/EBE firm who would have at least 3 years of experience utilizing the specified ADS monitoring equipment (as specified in Bid 18-03 document).Therefore a waiver is granted. CC: Ashley King, Interim Chief Financial Officer / City Treasurer Memorandum 138 of 549 For City Council meeting of February 12, 2018 Item A3.9 Business of the City by Motion: Collection of Soft Recyclables For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David Stoneback, Public Works Agency Director Paul D’Agostino, Environmental Service Coordinator Subject: Recycling Agreement – Collection of Soft Recyclables Date: January 30, 2018 Recommended Action Staff recommends that City Council authorize the City Manager to execute a five-year contract for residential soft recycling services with Great Lakes Recycling, Inc. d/b/a Simple Recycling, (5425 Naiman Parkway, Solon, OH). Funding Source There is no City funding required for this contract agreement. Livability Benefits: Climate & Energy: Reduce material waste Economy & Jobs: Support green jobs and businesses Background: In the spring of 2016, staff was contacted by a representative of Simple Recycling to discuss the potential of adding curbside “Soft Recycling” services on a weekly basis. Their proposal for services will not require any City funding, as they propose to furnish all containers and vehicles needed for curbside pickups. The company has already set up successful service contracts in 3 states (Ohio, Texas, and Michigan) and includes 41 municipalities. The proposal would allow residents of single family homes or buildings of 5 units or less the ability to recycle a multitude of materials on a weekly basis. These materials are not currently handled by the City’s weekly recycling program, but some are accepted at our annual recycling event each July. They do not plan to offer their services to any commercial businesses at this time. In order to set up the initial service contract, the Memorandum 139 of 549 company requires one or more adjacent municipalities within a forty (40) mile radius with a minimum of forty thousand (40,000) households, and be scalable in the future to a minimum of one hundred thousand (100,000) households within a forty (40) mile radius, based on the municipalities’ collection censuses. During early discussions with the company, both the Village of Skokie and the Village of Lincolnwood expressed a high level of interest in joining the program if the City of Evanston moved forward. Both Villages have already signed a contract and are now offering the service to their residents. The term “Soft Recyclables” is defined as items of an individual weight less than fifty (50) pounds that can be carried by one person. Soft Recyclables include primarily men’s, women’s and children’s clothing as well as items such as jewelry, shoes, purses, hats, toys, pictures, mirrors, blankets, drapes and curtains, pillows, rags, sewing scraps, sleeping bags, small furniture, small appliances, irons, radios and audio equipment, TVs and video equipment, cameras, lamps, hairdryers, tools, toasters, microwaves, coffee makers, computers and household or consumer electronics, silverware, dishes, pots and pans, glasses and the like. Excluded Items from the program include garbage, hazardous waste, large furniture, large appliances such as refrigerators, stoves, washers and dryers, magazines, newspapers, car seats, cribs, mattresses, paint, tires, cleaners, etc. and any item heavier than fifty (50) pounds. Summary Once the program begins, the Contractor will pay to the City of Evanston a contract fee of One Cent ($0.01) per pound of gross receipts of Soft Recyclables picked up within the City of Evanston’s portion of their Service Area. Based on a staff review of other cities already using this service, payments range from a low of $60 per month to a high of $250 per month. While these revenues are not significant, the program has the potential to divert a large amount of material from the landfill, which will reduce our annual tipping fees to SWANCC. The Contractor uses Ford Transit vans for the pickups, rather than large diesel fuel trucks. They will also provide, at their cost, all necessary containers/bags that residents use to set their recyclables out, and will schedule the weekly pickups using our existing routes and days of the week to schedule their work. The Contractor has also expressed a willingness to work with the City to be incorporated into our 311 system to communicate missed pickups, program questions and/or complaints and for tracking purposes. The Contractor has also committed to a robust publication information and education program, as outlined in section 11 of the Agreement. Attachments: Proposed Contract Agreement 140 of 549 AGREEMENT FOR COLLECTION OF SOFT RECYCLABLES This Agreement for the Collection of Soft Recyclables (“Agreement”) is made and entered into this___ day of _________, 20____, (the “Date of Execution”) by and between the City of Evanston, IL, a municipal corporation (herein referred to as “CITY”), and Great Lakes Recycling, Inc. d/b/a Simple Recycling, an Ohio corporation with a business address at 5425 Naiman Parkway, Solon, OH 44139 (together which with its successors and assigns, herein referred to as "Contractor"). WHEREAS, Contractor is skilled and experienced in the collection and efficient recycling and disposition of Soft Recyclables; and WHEREAS, CITY desires to limit and restrict the quantity of Soft Recyclables which are deposited in the landfill; and WHEREAS, CITY selected Contractor to collect, identify, haul, recycle and/or dispose of Soft Recyclables in the CITY’s Service Area; and WHEREAS, Contractor can provide such services and is in the business of and has the expertise, experience, resources and capability to perform the collecting, identifying, packaging, hauling, recycling and/or disposing of Soft Recyclables; and Contractor and CITY (herein collectively called the “Parties”) agree as follows: 1. Term. This Agreement shall begin upon the Date of Execution and continue for an initial term of five (5) years (the “Initial Term”). At the end of the Initial Term CITY may renew for an additional five (5) year term (the “Extension Term”). The City will provide written notice to Contractor at least sixty (60) days prior to the end of the Initial Term regarding renewal. During either Term, Contractor has the sole and exclusive right to pick up Soft Recyclables in the CITY’S Service Area through municipal contracted pick up. 2. Contractor’s Program Commencement. During the Term, Contractor agrees to begin providing program services a date no later than the ___ day of _________, 20____, (the “Date of Commencement”). The Date of Commencement will be no later than twelve (12) months from the Date of Execution of this Agreement. On the Date of Commencement, Contractor agrees to furnish all labor, equipment, tools, and services required and necessary for the collection and disposal of Soft Recyclables within CITY and the Service Area and provide qualified supervisory personnel to direct the activities of Contractor under this Agreement. 3. Collection Procedures. During the Term and after the Date of Commencement, Contractor must collect all acceptable Soft Recyclables set-out for recycling and collection by Residential Customers in approved Containers. The decision of what is an "acceptable" Soft Recyclable will be made in the sole reasonable discretion of Contractor; however, Contractor must identify “acceptable” Soft Recyclables with the City prior to the Date of Commencement. Contractor will not be required to accept any Excluded Items (excluded items include, but are not limited to the following items: garbage, hazardous waste, carpet, newspapers, mattresses, large furniture, large appliances, yard waste) and in no event shall Contractor provide service to 141 of 549 2 Commercial Customers. Contractor shall not be responsible for collecting Soft Recyclables which have fallen or been placed Curbside but are not in a Container. Contractor agrees to operate collection vehicles in such a manner to prevent materials from being blown from the vehicle. If at any time during collection and transport, Soft Recyclables are spilled onto a street, sidewalk, or private property, Contractor must immediately clean up and place in the collection vehicle all Soft Recyclables before the vehicle proceeds to the next stop on the collection route , or, it must promptly make all other reasonably necessary arrangements for the immediate clean- up of spilled Soft Recyclables. Contractor agrees to remove and dispose of all Soft Recyclables at no cost to CITY. 4. Ownership. Soft Recyclables set out for collection on the regularly scheduled collection day will belong to Contractor from the time of its set-out. Soft Recyclables physically collected by Contractor will be deemed acceptable Soft Recyclables for the purposes of its obligations under this Agreement. 5. Set Out Procedures. Residents will place Soft Recyclables into Containers and place Containers at the same locations of their refuse, yard waste and recycling containers for collection. CITY shall provide Contractor with collection maps detailing where collection occurs in alleyway versus curbside. Overflow material will be placed adjacent to the Container(s) in plastic bags or other easily handled container, and not set out in tied bundles. Contractor must collect all Soft Recyclables that are set out in this manner and are placed within seven (7) feet of the Curbside. Containers will be placed in a manner that will not interfere with or endanger the movement of vehicles or pedestrians. When construction work is being performed in the right- of-way, Containers will be placed as close as practicable to an access point for the collection vehicle. Contractor may decline to collect any Soft Recyclables not set out in accordance with this paragraph, and must promptly notify City regarding the location and reason for all declined collections. 6. Contamination and Improper Set Out. If Contractor encounters any improperly packaged Soft Recyclables or other contaminants in the Container, Contractor will not pick up the Container. Contractor must place a tag on the contaminant(s) that is not collected, and leave container behind. The Contractor must notify the City of the locations of all tagged containers within 24 hours of tagging. 7. Collection Schedule. Contractor must divide the Service Area into collection areas to coincide with CITY collection dates. Collections must be made from Service Recipients on a regular schedule in accordance with the existing CITY recycling pickup schedule. Contractor shall not be required to perform any service under this Agreement on Holidays. In December of each year the City will provide Contractor with a revised holiday collection schedule for the following year. 8. Missed Collections and Complaints. Service Recipients will report missed collections and complaints to Contractor and/or the CITY via the City of Evanston 311 System. The Program Brochure and other program information shall include contact information for the Contractor to facilitate communication from Service Recipients. Contractor must conduct a daily review of the reported missed collections and complaints directly submitted to the 142 of 549 3 Contractor, as well as those submitted via the City of Evanston 311 System. Contractor must give prompt and courteous attention to all reported missed collections and complaints, and must respond to and correct all missed collections and complaints. 9. Inventory of Containers. During the term of this Agreement, Contractor must purchase (at its sole cost) and maintain an inventory of acceptable and approved Containers for distribution to Service Recipients. Prior to commencement of service under this Agreement, Contractor shall provide new Containers to each Service Recipient. Containers shall initially be delivered to Service Recipients with an informational brochure on the recycling collection program described herein that is produced and printed by the contractor and approved by CITY, which approval shall not be unreasonably withheld (the “Program Brochure”). 10. Contractor’s Fee. Contractor must pay to CITY a contract fee of One Cent ($0.01) per pound of gross receipts of Soft Recyclables in the CITY’S portion of the Service Area. Payments shall be made to CITY not more than thirty (30) days following the close of each calendar month during the term of this Agreement. Weight shall be collected and documented upon completion of each collection day. 11. Publication Information and Education Program. CITY will provide public information in the normal course to inform Service Recipients of this recycling program. The content and timing of CITY public information will be coordinated with Contractor. Contractor may prepare and distribute its own promotional materials subject to CITY approval, which approval will not be unreasonably withheld. Contractor must participate in CITY directed promotion and education efforts as outlined below: a. During the course of the routine recycling pick up, provide and distribute notices regarding rejected materials and proper set out procedures. b. Training of employees to deal courteously with customers on the telephone and on-route to promote the collection service and explain proper material preparation. c. Coordinate with CITY for distribution of written promotional and instructional materials directly to Service Recipients. d. Be available a minimum of two times per year to participate in promoting the collection service at an area fair, neighborhood association program, school, or community event. e. Provide advice to CITY on promotion and education material content and presentation. 12. Telephone and Customer Service. Contractor shall maintain and staff a local toll- free telephone number where complaints of Service Recipients shall be received, recorded and handled by Contractor, between the hours of 9:00 AM and 4:30 PM Monday through Friday, excluding Holidays. Typically, all "call backs" shall be attempted a minimum of one time prior to 6:00 p.m. on the day of the call. If the caller is not contacted on the first attempt, Contractor shall make subsequent attempts on the next working day after the original call. Contractor shall 143 of 549 4 make a minimum of three (3) attempts within twenty-four (24) hours of the receipt of the call. All attempts to contact the caller shall be recorded on a log kept by Contractor. 13. Marketing and Disposition of Recyclable Material. Contractor shall be solely responsible for the marketing and sale of collected Soft Recyclables, and shall be solely responsible for the storage and disposition of the Soft Recyclables in the event it is unable to sell the Soft Recyclables in a timely manner. 14. Insurance. During the term of this Agreement Contractor agrees to keep in force, with an insurance company licensed to transact business in Illinois, an "occurrence basis" insurance policy or policies indemnifying, defending and saving harmless CITY from all damages (except for damages caused by CITY's own negligence, willful misconduct or failure) which may be occasioned to any person, firm, or corporation, whether damages are by reason of any willful or negligent act or acts on part of Contractor, its agents or employees, with limits no less than: a. General Liability: One Million and no/100 Dollars ($1,000,000.00) combined single limit per occurrence for bodily injury, personal injury, and property damage. b. Vehicle Liability: Two Million and no/100 Dollars ($2,000,000.00) combined single limit per accident for bodily injury and property damage. c. Worker's Compensation: Limits as required by the State of Illinois. The general liability provisions in automobile liability policies are to contain, or be endorsed to contain, the following provisions: (i) CITY, its officers, officials, employees, and volunteers are to be covered as insureds as respects: liability arising out of activities performed by or on behalf of Contractor; products and completed operations of Contractor; premises owned, occupied, or used by Contractor; or automobiles owned, leased, hired, or borrowed by Contractor. (ii) Contractor's insurance coverage shall be primary insurance as CITY, its officers, officials, employees, and volunteers. Any insurance or self-insurance maintained by CITY, its officers, officials, employees, or volunteers shall be in excess of Contractor's insurance and shall not contribute with it. (iii) Any failure to comply with reporting provisions of the policy shall not affect coverage provided to CITY, its officers, officials, employees, or volunteers. (iv) Contractor's insurance shall apply separate to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer's liability. (v) Each insurance policy required by this clause shall be endorsed to stat e that coverage shall not be suspended, voided, canceled by either party, nor reduced in coverage or in limits except after thirty (30) days' prior written notice has been given to CITY. 15. Indemnification and Hold Harmless. Contractor shall save, keep, and hold harmless CITY, its officers, agents, employees, and volunteers from all damages, costs, or expenses in law or equity that may at any time arise or be set up because of damages to property or personal injury received by reason of or in the course of performing work which may be occasioned by 144 of 549 5 any willful or negligent act or omission of Contractor, any of Contractor's employees, or any subcontractor. The provisions of this paragraph shall survive the expiration or termination of this Agreement. 16. Compliance with Law. Contractor agrees to comply with all published ordinances, laws, rules, and regulations, together with amendments thereto, of Illinois, the United States of America, or the City of Evanston pertaining to the services to be performed hereunder. 17. Taxes. Contractor agrees to save CITY harmless from any and all taxes or assessments of any kind or nature levied by any political subdivision upon Contractor by reason of services rendered for Soft Recyclables and disposal for CITY. 18. Employee Conduct. All Contractor personnel must maintain a courteous and respectful attitude toward the public at all times. At no time may they solicit, request or receive gratuities of any kind. Contractor must direct its employees to avoid loud and/or profane language at all times during the performance of duties. Any employee of Contractor who engages in misconduct or is incompetent or negligent in the proper performance of duties or is disorderly, dishonest, intoxicated, or discourteous must be immediately removed from service by Contractor. 19. Monthly Reports. Contractor must provide monthly project status reports to City. These reports will be due within fifteen (15) days of the close of the month being reported. At a minimum, the reports shall include detailed data to allow analysis of collection and processing efficiencies including pounds of Soft Recyclables collected, by collection route if possible, in the prior month and the payment of the required fee to CITY. Hard copy reports are submitted with payment for prior month’s collection data. In addition, the Contractor shall provide standard route mileage in Evanston upon request. In the event the Contractor is unable to sell collected Soft Recyclables from Evanston the Contractor must include a statement indicating which materials were unable to be sold, an estimate of their weight and how items were disposed. 20. Inspections. Upon reasonable advanced request to Contractor, CITY may inspect the facilities, equipment and operations of Contractor to assure itself of the appearance and compliance with provisions of this Agreement. Upon reasonable advance request, CITY may review the records kept on the Soft Recyclables collected under the terms of this Agreement to test and validate the weights claimed. CITY agrees to notify Contractor, in writing, at least forty- eight (48) hours prior to any such inspection and shall indicate the reasonable basis for requesting the inspection. 21. Meetings and Communications. In order to minimize misunderstanding and to provide thereafter a forum for discussing and resolving any issues that may arise, the parties agree to meet on a regular basis and hereby adopt communications procedures as follows: Meetings After Collection Begins. After Collections begin, meetings shall be held no less frequently than a quarterly basis, unless otherwise mutually agreed, between 145 of 549 6 representatives of the parties. Such meetings will be held for the purpose of reviewing and discussing day-to-day operations, promotion, public information and public relations. Designation of Representatives. Each party shall send at least one representative to each meeting. CITY shall send to each meeting at least one staff member with operation expertise. Each party shall designate one, and only one, representative as its Lead Representative. If a party sends only one representative to any meeting, that person shall be conclusively presumed to be its Lead Representative. 22. Compliance with Laws and Regulations. Contractor agrees that, in performance of work and services under this contract, Contractor will qualify under and comply with any and all applicable federal, State and local laws and regulations now in effect, or hereafter enacted during the Term, which are applicable to Contractor, its employees, agents or subcontractors, if any, with respect to the work and services described herein. Illinois law will govern and apply to any dispute under this Agreement. 23. Termination and Breach. Either party may terminate this Agreement without cause upon one hundred eighty (180) days written notice. However, should CITY elect to terminate this Agreement for-cause due to an uncured breach by the Contractor, CITY shall not be precluded from entering into any other agreement for the collection, identification, packaging, hauling, recycling and/or disposing of Soft Recyclables. In the event of a breach of the terms and conditions of this Agreement by either Party hereunder, the non-breaching Party may elect to terminate this Agreement by providing the defaulting Party with a written notice of such default, and allowing the breaching Party a period of thirty (30) days from and after the date of such notice to cure the breach complained of to the satisfaction of the non-breaching Party. In the event said breach is not cured within the thirty (30) day period, this Agreement shall be terminated (for-cause) as of the last day of the period. In the event CITY is the non-defaulting party, Contractor agrees to furnish services under this Agreement until such time as another Soft Recyclables collection and disposal contractor can be selected by CITY. 24. Severability. Should one or more of the provisions of this Agreement be held by any court to be invalid, void or unenforceable, the remaining provisions shall nevertheless remain and continue in full force and effect, provided that the continuation of such remaining provisions does not materially change the original intent of this Agreement. 25. Independent Contractor Status. In the performance of services pursuant to this Agreement, Contractor is an independent contractor and not an officer, agent, servant or employee of CITY. Contractor retains exclusive control over the details of the service and work performed under the Agreement, and over all persons performing such service and work. Contractor is solely responsible for the acts and omissions of its officers, agents, employees, Contractors and subcontractors, if any. Neither Contractor, nor its officers, agents, employees or subcontractors have or will have any right to retirement benefits, Workers’ Compensation benefits, or any other benefits which accrue to CITY employees. 146 of 549 7 26. No Assignment. This Agreement, or any interest herein, may not be transferred, sold, nor assigned by either Party to any person, firm, or corporation, without the prior written consent of the other Party. 27. Definitions. a. Commercial Customer: The term "Commercial Customer" means non-residential customers, including businesses, public or private schools, institutions, governmental agencies and all other users of commercial-type Garbage collection services. b. Container: The term “Container” means a bag, supplied by Contractor for use by the Residential Customer to set out Soft Recyclables. c. Curb or Curbside: The words "Curb" or "Curbside" relate to the homeowners' property, within five (5) feet of the Public Street or Private Road without blocking sidewalks, driveways or on-street parking. If circumstances preclude, a Curbside shall be considered a placement suitable to the resident, convenient to Contractor's equipment, and mutually agreed to by CITY and Contractor. d. Excluded Items: The term “Excluded Items” means Garbage, Hazardous Waste, large furniture, large appliances such as refrigerators, stoves, washers and dryers, magazines, newspapers, car seats, cribs, mattresses, paint, tires, cleaners, etc. and any item heavier than fifty (50) pounds. e. Garbage: The term “Garbage” means all putrescrible and non-putrescrible solid and semi-solid wastes, including, but not limited to, rubbish, ashes, industrial wastes, grass, yard debris, leaves, swill, demolition and construction wastes, dead animals piles of debris, car parts, construction or demolition debris, any item that would be considered Hazardous Waste, or stumps. f. Hazardous Waste: The term "Hazardous Waste" means any hazardous, toxic or dangerous waste, substance or material, or contaminant, pollutant or chemical, known or unknown, defined or identified as such in any existing or future local, state or federal law, statute, code, ordinance, rule, regulation, guideline, decree or order relating to human health or the environment or environmental conditions, including but not limited to any substance that is defined as hazardous by 4 0 C .F .R. Part 2 61 and regulated as hazardous waste by the United States Environmental Protection Agency under Subtitle C of the Resource Conservation and Recovery Act ("RCRA") of 1976, 42 U.S.C. § 6901 et seq., as amended by the Hazardous and Solid Waste Amendments ("HSWA") of 1984; the Toxic Substances Control Act, 15 U.S.C. § 2601 et seq.; or any other federal statute or regulation governing the treatment, storage, handling or disposal of waste imposing special handling or disposal requirements similar to those required by Subtitle C of RCRA or any Illinois statute or regulation governing the treatment, storage, handling or disposal of wastes and imposing special handling requirements similar to those required by federal law. g. Holiday: The term “Holiday” means the following days: New Year’s Day, Martin Luther King’s Day, President’s Day, Memorial Day, Independence Day, Labor Day, Columbus Day, Veteran’s Day, Thanksgiving Day and Christmas Day, unless otherwise specified by the CITY recycling holiday schedule. h. Residential Customer: The term “Residential Customer” means and individual or individuals residing in a living space rented, leased or owned. 147 of 549 8 i. Service Area: The term "Service Area" means the municipal corporate limits of CITY plus, if necessary, one or more adjacent municipalities within a forty (40) mile radius with a minimum of forty thousand (40,000) households and be scalable to a minimum of one hundred thousand (100,000) households within a forty (40) mile radius, based on the municipalities’ collection censuses. The Service Area will encompass all of CITY’S trash and recycling collection area, as it may be amended from time to time. j. Service Recipients: The term “Service Recipients” means Residential Customers of CITY in the Service Area. k. Soft Recyclable: The term “Soft Recyclable” means items of an individual weight less than fifty (50) pounds and can be carried by one person. Soft Recyclables include primarily men’s, women’s and children’s clothing as well as items such as jewelry, shoes, purses, hats, toys, pictures, mirrors, blankets, drapes and curtains, pillows, rags, sewing scraps, sleeping bags, small furniture, small appliances, irons, radios and audio equipment, TVs and video equipment, cameras, lamps, hairdryers, tools, toasters, microwaves, coffee makers, computers and household or consumer electronics, silverware, dishes, pots and pans, glasses and the like. The parties executed this Agreement as of the Date of Execution first written above. CITY By: Its: City Manager Great Lakes Recycling, Inc. d/b/a Simple Recycling By: _______________________________ Adam Winfield, President 148 of 549 For City Council meeting of February 12, 2018 Item A3.10 Business of the City by Motion – MWRD Annual User Charges For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David D. Stoneback, Public Works Agency Director Darrell A. King, Water Production Bureau Chief Subject: Estimated Annual User Charge for 2018 with the Metropolitan Water Reclamation District of Greater Chicago for Disposal of Sludge Generated as Part of the Water Treatment Process Date: January 31, 2018 Recommended Action: Staff recommends City Council approval of the Estimated Annual User Charge for 2018 with the Metropolitan Water Reclamation District of Greater Chicago (MWRDGC) for Disposal of Sludge generated as part of the water treatment process in the amount $180,086.68. Four payments of $45,021.67 will be made beginning in February 2018 and ending November 2018. Funding Source: Funding for this work will be from the Water Fund, Account 510.40.4220.62420. This account has a budget of $300,000.00 allocated for MWRDGC sludge disposal fees. The YTD account balance equals $300,000.00. Livability Benefits: Built Environment: Manage water resources responsibly. Health & Safety: Improve health outcomes. Summary: The initial phase of the water treatment process involves adding coagulants to raw Lake Michigan water in order to form a “floc” which helps to trap and solidify impurities in the water and allow them to settle out prior to filtration. This material settles out as part of the mixing, sedimentation and settling process into basins located underground on the north side of the Water Treatment Facility. During October and April of each year, this sediment, or sludge, is removed from the basins by manually washing and rinsing it into a sewer and sending it to the MWRDGC for treatment. The makeup of this sludge varies greatly depending on the time of the year, the turbidity (cloudiness) of the raw water and the utilization and demand for water. The sludge is analyzed for biological oxygen Memorandum 149 of 549 demand (BOD) and suspended solids (SS) prior to pumping to the MWRDGC and the cost for treatment is based on the levels of these parameters as well as the volume of sludge that has been produced. The MWRD determines an annual amount for the coming year based on the data from the previous year and bills the City on a pro-rated quarterly basis. In January of each year, a “true up” calculation is determined using the BOD, SS and volume data. Depending on these results, there is either an additional payment if the estimate was low or a credit to the City if the estimate was high. This method of sludge disposal has been utilized at the water treatment plant for over 50 years. Staff has researched other options for the removal and disposal of the sludge generated as part of the water treatment process. There are very few other means of removal and all of these methods would require the dewatering and drying of the sludge to a degree where it could be trucked away. The space available at the treatment plant site prohibits the installation of drying beds, silos or centrifuges that would be needed to dewater/ dry the sludge. It should be noted that the other water treatment facilities within the MWRDGC service area continue to discharge their sludge to the MWRDGC due to the same space and capital cost limitations that prevent Evanston from implementing a different sludge disposal methodology. MWRDGC Annual User Charge Payment History Table 1 below depicts historic MWRDGC Annual User Charge payments and credits processed 2017 – 2011. During 2014 The City of Evanston received a credit in the amount of $261,565.15 ($130,782.58 – credit; $130,782.57 – refunded to City of Evanston on 09/10/2015 check #385391). Credits were also awarded during 2015 ($3,414.47), 2012 ($63,507.82) and 2011 ($60.06). *Column labeled “Final Settlement” indicates credits as a result of City overpayment or additional payment required. Table 1 2017-2011 MWRDGC Annual User Charge Year Initial Payments Made Final Settlement Final Amount 2017 $187,901.35 True-Up in Progress (estimated) $155,471.97 2016 $195,545.61 Owed to MWRDGC $29,014.91 $224,560.52 2015 $236,598.68 Refunded to COE -$3,414.47 $233,184.21 2014 $349,126.64 Refunded to COE -$261,565.15 $87,561.49 2013 $413,489.59 - $413,489.59 2012 $476,006.92 Refunded to COE -$63,507.82 $412,499.10 2011 $790,354.20 Refunded to COE -$60.06 $790,294.14 150 of 549 Legislative History: The Annual MWRDGC Sludge Removal User Fee was last approved by City Council during 2017.on February 13, 2017. Attachments: RD-913 Statement 151 of 549 152 of 549 For City Council meeting of February 12, 2018 Item A3.11 Business of the City by Motion: Oversize & Overweight Truck Permitting Contract For Action To: Honorable Mayor and Members of the City Council Members of the Administration and Public Works Committee From: David D. Stoneback, Public Works Agency Director Rajeev Dahal, Senior Project Manager - Transportation Subject: Award Contract with Oxcart Permit Systems, LLC Oversize & Overweight Truck Permitting On-line Application & Processing Date: February 1, 2018 Recommended Action: Staff recommends the City Council authorize the City Manager to execute an on-line application and processing contract for oversize and overweight truck permits with Oxcart Permits System, LLC., (440 W Colfax, Suite 2384, Palatine, IL 60078) pending approval of Ordinance 9-O-18 – Permits for Excessive Weight and Size. Funding Source: N/A Livability Benefits: Built Environment: enhance public spaces Health & Safety: improve emergency prevention and response Summary: Per State Law, a permit is required to operate or move any vehicle or combination of vehicles upon any street that exceeds the maximum weight, height, or length limitations set forth in 625 ILCS 5/15-100 of the Illinois Vehicle Code. Staff currently issues approximately 250 permits per year over the phone to applicants upon verifying their State permit, destination and routing information and records it in a excel spreadsheet. There has not been a good system to assess permit fees without causing applicants to come in to the City for a permit, and proper management of staff time and resources in receiving, reviewing and processing the applications in a timely basis. Further, it is difficult for Evanston Police Department to enforce the permit conditions without the truck drivers having a hard copy of the permit. With the Oxcart Permit System, these Memorandum 153 of 549 concerns can be addressed without overburdening staff resources especially since truck operators are already familiar with the system. The Oxcart Permit System is already being used by over 50 governmental agencies in the State, including Buffalo Grove, Deerfield, Glenview, Mr. Prospect, Palatine, Park Ridge and Wheeling in the Chicagoland area. The Oxcart on-line system will also alert the operators that they need an Evanston permit for streets under the City jurisdiction when they access the State permit system. Under the agreement, Oxcart will process the applicants permit, issue such permits after staff review and approval of the application, collect the permit fees and service charges from the applicant, and reimburse the City the fees collected on a monthly basis. They will maintain all records and transactions for review and auditing by the City as needed. Their service fee schedule is as follows: The contract allows either party to terminate the agreement without penalty by either party for any reasons upon sixty (60) day notice to the other party. In addition to approving these permits, City engineering staff will continue to provide over the phone service to truck operators who do not need oversize or overweight permits but have concerns regarding their routes due to viaduct clearances. Staff processes over a hundred of these requests every year. Analysis: Taking into consideration the number of permits issues each year, Staff estimates the program to generate $15,000 - $20,000 revenue per year. Per the agreement, neither the City nor Oxcart will charge a fee to applicants that are working on construction projects under City contract. Attachment: Professional Service Agreement with Oxcart Permit System City Permit Fee Oxcart Fee $0.00 - $49.99 $5.00 flat fee $50.00 - $99.99 10% $100.00 - $199.99 $12.50 flat fee $200.00 or more $15.00 flat fee 154 of 549 155 of 549 156 of 549 157 of 549 158 of 549 159 of 549 160 of 549 161 of 549 162 of 549 163 of 549 164 of 549 165 of 549 For City Council meeting of February 12, 2018 Item A3.12 Business of the City by Motion: Revision to Street Cleaning Schedule For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David P. Stoneback, Director of Public Works Edgar Cano, Public Services Bureau Chief Kevin M. Johnson, Recycling and Environmental Maintenance Supervisor Subject: Revision of Street Sweeping Schedule Date: January 29, 2018 Recommended Action: Public Works Agency staff recommends revising the street cleaning schedule in 2018 to eliminate the special cleaning areas in Zone 4, changing the days that streets in Zone 4 are cleaned to the fourth Tuesday/Wednesday of the month, and reduce the number of residential streets that are cleaned overnight (4AM to 7AM). Staff also recommends revising the street cleaning schedule to a Tuesday/Wednesday schedule for Zone 3 in 2019, Zone 2 in 2020 and Zone 1 in 2021. Funding Source: The estimated cost of $3,000 to purchase stickers to reflect the proposed changes on the existing signs would be funded from Account 100.40.4105.65515/Public Works Agency-Other Improvements with a FY18 Budget of $3,000. Livability benefits: Built Environment: Enhance Public Spaces Equity and Empowerment: Ensure Equitable Access to Community Assets Natural Systems: Protect and Restore Natural Ecosystems Discussion and background: The City’s current scheduled street cleaning operations for daytime residential routes occur on Thursdays and Fridays, and primary routes occur Tuesday through Friday, between the dates of March 1st and December 15th. Streets are posted to reflect those days along with specific time frames (4-7AM, 9AM-1PM, Noon-4PM). The City is divided into four street cleaning zones, with each zone posted for cleaning once a month. Zone 1 is swept on the first Thursday/Friday of each month. Zone 2 is swept on the second Thursday /Friday of each month. Zone 3 is swept on the third Thursday/Friday of each month; and Zone 4 is swept on the fourth Thursday/Friday of each month. South/West side of streets in a zone are swept on Thursdays, while the North/East side of the streets are swept on Fridays. Memorandum 166 of 549 City staff has evaluated current street cleaning schedules and believes revisions to the posted sweeping days are needed in order to improve operational efficiency and provide better service to both residents and visitors. With the Thanksgiving holiday being observed on the fourth Thursday/Friday in November, issues are created for both residents in street cleaning Zone 4, as well as for City operations. With this occurring in the middle of leaf season, it only adds to the necessity of having the streets cleaned during this month. A missed sweep due to the holiday would mean Zone 4 would not be swept again due to street cleaning operations ending on December 15th. Past attempts made by the City in order to ensure service for Zone 4 residents were to add additional fall cleaning during the months of November and December, as well as a “special” zone 4 street cleaning schedule. Though these actions do aid in the cleaning, they result in an inconvenience to residents and visitors in the form of additional parking restrictions. Staff examined potential shifts in the street cleaning schedule to address these issues and believes switching Zone 4 street cleaning schedules to the fourth Tuesday/Wednesday of each month would improve operations and the service provided to our residents. This new schedule would allow for street cleaning operations in Zone 4 to occur in November, during leaf season, when it is most essential while negating the need of “special” street cleaning schedules. Staff has developed a proposed revision to the street cleaning schedule which includes: • Moving all streets sweeping to Tuesday/Wednesday from the current schedule of Thursday/Friday. Staff proposes to start with Zone 4 this year since it is the zone that would benefit the most from this change. • So as to not be a strain on both budget and manpower, as well as give residents a time to adjust, staff recommends changing the remaining three zones, one zone per year. • Remove special area sweeping in zone 4 • Moving the 4AM-7PM residential two sided street cleaning back to the daytime sweeping schedule of 9AM-1PM and Noon to 4PM. Moving the current 4AM to 7AM residential two sided street cleaning to daytime hours of 9AM-1PM and Noon-4PM would allow residents to have overnight parking on their posted street and reduce the inconvenience of having to move their vehicle or find alternative parking. The locations of the streets where this shift is proposed to occur are listed in Exhibit 1 attached. According to City Code, 10-4-12. – Street Cleaning, any changes to the schedule of the street sweeping must be approved by the Administration and Public Works Committee: “To facilitate the cleaning of streets within the City, signs giving notice of the street cleaning schedule shall be posted on streets or portions thereof by the City Manager or his/her designee. Where such signs are posted, it is a violation of this Section to park a vehicle on the days and between the times specified on the signs. Any changes to the street cleaning schedule must be approved by the Administration and Public Works Committee.” 167 of 549 If approved, changes to the current street cleaning signs will have to be made. Staff recommends placing stickers with the updated information over the current signs. In addition, street cleaning maps will have to be updated and a notice will have to be sent to the residents advising of and explaining the changes. The cost of the stickers to modify the signs is approximately $3,000. Crews working the winter night-time shift would remove and replace the signs prior to the March 1 street sweeping start date. Attachments: Current Street Cleaning Map Exhibit 1 – Locations shifted from Overnight to Daytime Street Cleaning Proposed Street Cleaning Map 168 of 549 McCORMICK BLVDS H E R IDAN RD PARK PL ASHLAND AVEDODGE AVEHURD AVEGIRARD AVELEE STOAK AVE SHERIDAN PL RIDGE CTG R E E N B A Y R D THAYER ST PRATT CTGRANT JENKS ST HAVEN ST PAYNE ST LEON PL P O P L A R A V E GREY AVEHARRISON ST PR A I R I E A V E REBA PL COLFAX ST LEMAR AVEMARCY AVEDAVIS ST MAPLE AVEHARTZELL ST LIBRARY PL SIMPSON ST CLYDE AVEBROWN AVEGREELEYPITNER ALYLAUREL AVEHINMAN AVEDEWEY AVEEWING AVECOWPER AVEKIRK STHOVLAND CTJUDSON AVEGARRETT PLARBORLN FOREST AVEINGLESIDE PK GREY AVEST. MARK'S CTEMERSON ST CAMPUS DRSHERMAN AVEWILDER ST MILBURN PKGARRISON AVETHELIN CT FOREST PLASBURY AVEMICHIGAN AVEWESLEY AVELELAND AVECENTRAL ST CALLAN AVERIDGE TER HULL TER HOWARD ST ISABELLA ST GROSS POINT RDCUSTER AVEEMERSON ST LYONS ST FOWLER AVECLARK S T DARROW AVEPIONEER RDHASTINGS AVEHARTREY AVEBRUMMEL STPRINCETON AVEPROSPECT AVEHAMLIN ST PAYNE ELM AVECASE PLRIDGEWAY AVEMULFORD ST MICHIGAN AVELAWNDALE AVECHURCH S T CRAIN ST DEMPSTER STJACKSON AVEKEDZIE ST CLINTON PL McDANIEL AVEELMWOOD AVESEWARD ST ROSLYN PL E A S T R A I L R O A D A V E FLORENCE AVEBENSON AVESHERMAN PL CULVER FORESTVIEW RDMARTHA LNHAWTHORNE LN WADE CT BROWN AVECROFT LN COLFAX TER BROWNGREYBRI D G E ST CALVIN CIR BROWN AVERICHMOND AVENORMANDY PL WOODLAND RD ELINOR PL KEENEY ST SOUTH BLVD HAMILTON ST GREENWOOD ST UNIVERSITY PLREESE AVEAUTOBARN PL GAFFIELD PLLINCOLNWOOD DRCRAWFORD AVELEONARD PLCENTRAL PARK AVEBENNETT AVEMADISON PL BRADLEY PL GREENLEAF STWALNUT AVEROSALIE ST BURNHAM PL WARREN STLIVINGSTON WASHINGTON ST CLEVELAND ST MONTICELLO PL NATHANIEL PL HARVARD TERWOODBINE AVEMAPLE AVEDOBSON STDEWEY AVEDARROW AVEDEWEY AVEINGLESIDE PL RIDGE AVEASBURY AVEFOWLER AVEHARTREY AVECASE ST SOUTH BLVD ASHLAND AVESHERMAN AVELYONS ST ST E W A R T A V EMARCY AVEWELLINGTON CTCLEVELAND ST MONROE ST LINDEN PL LAKE SHORE BLVDKNOX CIRHILLSIDE LN TRINITY CT SHERIDAN SQEDGEMERE CTG R E E N B A Y R D GARNETT PL CENTRAL ST HARRISON RIDGEAVEPAYNE ST WESLEY AVECHURCH ST HARTZELL ST P R A I R I E A V E DODGE AVEOAKTON ST SOUTH BLVD CRAINMcDANIEL AVEPITNER AVELEE ST ASHLAND AVEGROVE ST FOSTER ST ASBURY AVEBARTON AVEGRANT ST BRYANT AVEJUDSON AVESHERMAN AVECOLFAX ST ISABELLA ST DAVIS ST MAIN ST RIDGE AVEASBURY AVET H A Y E R C T THAYER ST ISABELLA ST HAYES DARTMOUTH PL COLFAX PL THAYERTHAYERST C R A W F O R D LINCOLNWOOD DRLIVINGSTON ST CHANCELLOR ST CHANCELLORLIVINGSTON MILBURN ST LAKESIDE CT EUCLIDPARK PL WESLEYCLARK STLYONS ST GREY AVEDEWEY AVEPAYNE ST MAIN STDODGE AVECENTRAL ST McDANIEL AVEEWING AVESHERIDAN RDBRUMMEL STPITNER AVELINCOLN ST HINMAN AVE SEWARD ST WESLEY AVECENTRAL ST KEENEY ST RIDGE AVEOAK AVEJACKSONSHERMAN AVEDOBSON ST LINCOLN ST SEWARD STDARROW AVEGREY AVEPARK PL NOYES ST LAKE ST THAYER ST WASHINGTON ST LAKE STMcDANIEL AVEBROWN AVEAUSTIN STASHLAND AVEWESLEY AVETECH DR NOYES CTHAMPTON PKYOTTO LNBERNARD PLMEADOW-LARK LNRIDGE AVEELGI N R D ELMWOOD AVECOLFAX ST HINMAN AVESIMPSON ST WESLEY AVEOAKTON ST SHERIDAN RD SHERIDAN RD DEMPSTER ST GREY AVELEE ST SIMPSON ST CHICAGO AVECHICAGO AVEBENNETT AVEMADISON ST KEENEY STOAKRIDGE AVESHERIDAN RDGRANT ST ASBURY AVEGROVE S T ELG I N R D FLORENCE AVEFOREST AVEDODGE AVEFOSTER ST MULFORD ST GREENLEAF ST HILLSIDE RD HARTREY AVEHARTREY AVEGREY AVEARNOLD PLPITNER AVELINCOLN ST McCORMICK BLVDFOSTER STGREENWOOD ST CALLANPARK PL JUDSON AVE NOYES ST DARROW AVEASHLAND AVEHARRISON ST HOWARD ST NOYES GLENVIEW RD PRINCETONCLIFFORD ST HIGHLAND AVELAWNDALE AVEDARTMOUTH PL ARTSCIRCLE DRORRINGTON AVEEASTWOOD AVEBROADWAY AVEWASHINGTON ST NORTHWESTERNPL DRYDEN PL NORTH SHORE CHANNELNORTH SHORE CHANNELLAKEMICHIGAN700400 500300600 800200 900 1002600 1700 310012001900 1000 130014002200 2300 11001800280015003600 20002400 2700 34002100 250029001600300032003300 300600 2800 1900 1000 2700 400 2500 1400 800 1700 1600 700220024001400 200500 140020023002000 700 8002600 1200 22001500 16001200100 150013001002900190010005002100 220024001100 1100 2001300 28001000120026001500 2300 1800 2000700 300 900600400240025002000 13001800 300 800 6001100100 500 25002700 1600 17003500260017001800900190090021002300210040038003700¬«1B¬«1A ¬«2A ¬«2B ¬«4B¬«4A ¬«3A ¬«3B ¬«D ¬«SA ¬«SB 0 0.5 10.25 Mile 1:31,680 1 inch = 0.5 mile 2/17/2017 This map is provided "as is" without warranties of any kind. See www.cityofevanston.org/mapdisclaimers.html for more information. StreetCleaningLetterMap.mxd ´ Street Cleaning Zones Primary Route (4am-7am) Residential Overnight (4am-7am) Residential (9am-1pm or Noon-4pm) A/B Subzone Boundary Private Road Railroad City of Evanston Public Works Agency Sweeping Details Primary RoutesTwice a month: 4am-7am Residential OvernightOnce a month: 4am-7am Residential StreetsOnce a month"A" areas: Noon-4pm"B" areas: 9am-1pm(Additional dates in Zone 4 "S" areas) Check street signs for dates, call 311,or visitwww.cityofevanston.org/streetcleaning Note: Streets with one side only parkinghave their own sweeping schedule, andare swept once each month on Mondays. Note: Cars on all streets are subjectto towing for noncompliance. 169 of 549 Exhibit 1 Locations of Current Residential Overnight Street Sweeping Proposed to be Shifted to Daytime Street Sweeping Sweeping Zone 1: 2900 - 3300 blocks of Harrison return to days Noon - 4pm (Ward 6) 2700 block of Hurd return to days Noon - 4pm (Ward 6) - Near School 2900-2800 blocks of Lincoln return to days Noon - 4pm (Ward 6) 2200-2700 blocks of Lincoln return to days 9am - 1pm (Ward 6+7) 2500-2600 blocks of Ewing return to days 9am - 1pm (Ward 6) 2600-2700 blocks of Payne of return to days 9am - 1pm (Ward 6) 2800-2900 blocks of Payne return to days 9am - 1pm (Ward 6) Sweeping Zone 2: 1300-1400 blocks of Rosalie return to days Noon - 4pm (Ward 7) 2600 block of Orrington return to days Noon - 4pm (Ward 7) - Near School 1000, 1200 & 1700 blocks of Judson return to days 9am - 1pm (Ward 3+1) 1100-1200 blocks of Hinman return to days 9am - 1pm (Ward 3) 300-500 blocks of Hamilton return to days 9am - 1pm (Ward 3) 100-500 blocks of Greenleaf return to days 9am - 1pm (Ward 3) Sweeping Zone 3: 800 block of Greenwood return to days 9am - 1pm (Ward 3) 1300 block of Grove return to days Noon - 4pm (Ward 2+4) - Near School 1500 block of Lake return to days Noon - 4pm (Ward 2) - Near School 1400 block of Wesley return to days 9am - 1pm (Ward 4) 1500-1600 blocks of Wesley return to days Noon - 4pm (Ward 2+4) - Near School 170 of 549 McCORMICK BLVDS H E R IDAN RD PARK PL ASHLAND AVEDODGE AVEHURD AVEGIRARD AVELEE STOAK AVE SHERIDAN PL RIDGE CTG R E E N B A Y R D THAYER ST PRATT CTGRANT JENKS ST HAVEN ST PAYNE ST LEON PL P O P L A R A V E GREY AVEHARRISON ST PR A I R I E A V E REBA PL COLFAX ST LEMAR AVEMARCY AVEDAVIS ST MAPLE AVEHARTZELL ST LIBRARY PL SIMPSON ST CLYDE AVEBROWN AVEGREELEYPITNER ALYLAUREL AVEHINMAN AVEDEWEY AVEEWING AVECOWPER AVEKIRK STHOVLAND CTJUDSON AVEGARRETT PLARBORLN FOREST AVEINGLESIDE PK GREY AVEST. MARK'S CTEMERSON ST CAMPUS DRSHERMAN AVEWILDER ST MILBURN PKGARRISON AVETHELIN CT FOREST PLASBURY AVEMICHIGAN AVEWESLEY AVELELAND AVECENTRAL ST CALLAN AVERIDGE TER HULL TER HOWARD ST ISABELLA ST GROSS POINT RDCUSTER AVEEMERSON ST LYONS ST FOWLER AVECLARK S T DARROW AVEPIONEER RDHASTINGS AVEHARTREY AVEBRUMMEL STPRINCETON AVEPROSPECT AVEHAMLIN ST PAYNE ELM AVECASE PLRIDGEWAY AVEMULFORD ST MICHIGAN AVELAWNDALE AVECHURCH S T CRAIN ST DEMPSTER STJACKSON AVEKEDZIE ST CLINTON PL McDANIEL AVEELMWOOD AVESEWARD ST ROSLYN PL E A S T R A I L R O A D A V E FLORENCE AVEBENSON AVESHERMAN PL CULVER FORESTVIEW RDMARTHA LNHAWTHORNE LN WADE CT BROWN AVECROFT LN COLFAX TER BROWNGREYBRI D G E ST CALVIN CIR BROWN AVERICHMOND AVENORMANDY PL WOODLAND RD ELINOR PL KEENEY ST SOUTH BLVD HAMILTON ST GREENWOOD ST UNIVERSITY PLREESE AVEAUTOBARN PL GAFFIELD PLLINCOLNWOOD DRCRAWFORD AVELEONARD PLCENTRAL PARK AVEBENNETT AVEMADISON PL BRADLEY PL GREENLEAF STWALNUT AVEROSALIE ST BURNHAM PL WARREN STLIVINGSTON WASHINGTON ST CLEVELAND ST MONTICELLO PL NATHANIEL PL HARVARD TERWOODBINE AVEMAPLE AVEDOBSON STDEWEY AVEDARROW AVEDEWEY AVEINGLESIDE PL RIDGE AVEASBURY AVEFOWLER AVEHARTREY AVECASE ST SOUTH BLVD ASHLAND AVESHERMAN AVELYONS ST ST E W A R T A V EMARCY AVEWELLINGTON CTCLEVELAND ST MONROE ST LINDEN PL LAKE SHORE BLVDKNOX CIRHILLSIDE LN TRINITY CT SHERIDAN SQEDGEMERE CTG R E E N B A Y R D GARNETT PL CENTRAL ST HARRISON RIDGEAVEPAYNE ST WESLEY AVECHURCH ST HARTZELL ST P R A I R I E A V E DODGE AVEOAKTON ST SOUTH BLVD CRAINMcDANIEL AVEPITNER AVELEE ST ASHLAND AVEGROVE ST FOSTER ST ASBURY AVEBARTON AVEGRANT ST BRYANT AVEJUDSON AVESHERMAN AVECOLFAX ST ISABELLA ST DAVIS ST MAIN ST RIDGE AVEASBURY AVET H A Y E R C T THAYER ST ISABELLA ST HAYES DARTMOUTH PL COLFAX PL THAYERTHAYERST C R A W F O R D LINCOLNWOOD DRLIVINGSTON ST CHANCELLOR ST CHANCELLORLIVINGSTON MILBURN ST LAKESIDE CT EUCLIDPARK PL WESLEYCLARK STLYONS ST GREY AVEDEWEY AVEPAYNE ST MAIN STDODGE AVECENTRAL ST McDANIEL AVEEWING AVESHERIDAN RDBRUMMEL STPITNER AVELINCOLN ST HINMAN AVE SEWARD ST WESLEY AVECENTRAL ST KEENEY ST RIDGE AVEOAK AVEJACKSONSHERMAN AVEDOBSON ST LINCOLN ST SEWARD STDARROW AVEGREY AVEPARK PL NOYES ST LAKE ST THAYER ST WASHINGTON ST LAKE STMcDANIEL AVEBROWN AVEAUSTIN STASHLAND AVEWESLEY AVETECH DR NOYES CTHAMPTON PKYOTTO LNBERNARD PLMEADOW-LARK LNRIDGE AVEELGI N R D ELMWOOD AVECOLFAX ST HINMAN AVESIMPSON ST WESLEY AVEOAKTON ST SHERIDAN RD SHERIDAN RD DEMPSTER ST GREY AVELEE ST SIMPSON ST CHICAGO AVECHICAGO AVEBENNETT AVEMADISON ST KEENEY STOAKRIDGE AVESHERIDAN RDGRANT ST ASBURY AVEGROVE S T ELG I N R D FLORENCE AVEFOREST AVEDODGE AVEFOSTER ST MULFORD ST GREENLEAF ST HILLSIDE RD HARTREY AVEHARTREY AVEGREY AVEARNOLD PLPITNER AVELINCOLN ST McCORMICK BLVDFOSTER STGREENWOOD ST CALLANPARK PL JUDSON AVE NOYES ST DARROW AVEASHLAND AVEHARRISON ST HOWARD ST NOYES GLENVIEW RD PRINCETONCLIFFORD ST HIGHLAND AVELAWNDALE AVEDARTMOUTH PL ARTSCIRCLE DRORRINGTON AVEEASTWOOD AVEBROADWAY AVEWASHINGTON ST NORTHWESTERNPL DRYDEN PL NORTH SHORE CHANNELNORTH SHORE CHANNELLAKEMICHIGAN700400 500300600 800200 900 1002600 1700 310012001900 1000 130014002200 2300 11001800280015003600 20002400 2700 34002100 250029001600300032003300 300600 2800 1900 1000 2700 400 2500 1400 800 1700 1600 700220024001400 200500 140020023002000 700 8002600 1200 22001500 16001200100 150013001002900190010005002100 220024001100 1100 2001300 28001000120026001500 2300 1800 2000700 300 900600400240025002000 13001800 300 800 6001100100 500 25002700 1600 17003500260017001800900190090021002300210040038003700¬«1B¬«1A ¬«2A ¬«2B ¬«3A ¬«3B ¬«D ¬«4B¬«4A 0 0.5 10.25 Mile 1:31,680 1 inch = 0.5 mile 2/1/2018 This map is provided "as is" without warranties of any kind. See www.cityofevanston.org/mapdisclaimers.html for more information. StreetCleaningLetterMap.mxd ´ Proposed Street Cleaning Zones Primary Route (4am-7am) Residential Overnight (4am-7am) Residential (9am-1pm or Noon-4pm) A/B Subzone Boundary Private Road Railroad City of Evanston Public Works Agency Sweeping Details Primary RoutesTwice a month: 4am-7am Residential OvernightOnce a month: 4am-7am Residential StreetsOnce a month"A" areas: Noon-4pm"B" areas: 9am-1pm Check street signs for dates, call 311,or visitwww.cityofevanston.org/streetcleaning Note: Streets with one side only parkinghave their own sweeping schedule, andare swept once each month on Mondays. Note: Cars on all streets are subjectto towing for noncompliance. 171 of 549 For City Council meeting of February 12, 2018 Item A3.13 Business of the City by Motion: Water Treatment Plant Reliability Improvements Construction Change Order No. 3 For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David Stoneback, Public Works Agency Director Lara Biggs, P.E., Bureau Chief – Capital Planning / City Engineer Paul Moyano, P.E., PMP, Senior Project Manager Subject: Water Treatment Plant Reliability Improvements Construction (RFP 16-17) Change Order No. 3 – Project Close-Out Date: December 21, 2017 Recommended Action: Staff recommends that City Council authorize the City Manager to execute Change Order No. 3 for the Water Treatment Plant Reliability Improvements Project with Thieneman Construction, Inc. (TCI) (17219 Foundation Parkway, Westfield, IN 46074) for a deduction of $4,531.44 to the current contract amount to account for various minor changes to the work throughout the construction. This change order will decrease the total contract amount from the current contract price of $1,289,721.00 to $1,285,189.56, and extends the date of final completion date from October 29, 2017 to November 17, 2017. Funding Source: The Illinois Environment Protection Agency (IEPA) has agreed to provide a loan from the State Revolving Fund in an amount up to $1,634,816.00 for engineering and construction of this project. This amount includes a contingency of 3% ($37,410.00) of the bid price of the project. With this funding, all eligible engineering and construction costs will be funded by a loan repaid over 20 years at 1.64% interest. IEPA loan funding for this work is being routed through the Water Fund, Capital Improvement (Account 513.71.7330.65515 – 733094). This project has an overall project allocation of $2,500,000 funded in both 2016 and 2017. Livability Benefits: Built Environment: Manage Water Resources Responsibly. Reduce Environmental Impact: Improve energy and water efficiency. Health and Safety: Enhance resiliency to natural and human hazards. Memorandum 172 of 549 Background: The Water Treatment Plant Reliability Improvement Project has improved critical components of the plant, including the shore wells, chemical feed system, large diameter valves, conveyance ducts, site piping, electrical systems, and instrumentation, resulting in a more dependable water supply for all Evanston residents and wholesale water customers. The City Council authorized the City Manager to execute the agreement for Construction of the project to Thieneman Construction Inc. (TCI) for $1,247,000 on July 11, 2016. Notice to Proceed was issued on February 1, 2017 after the Loan was formally awarded by the IEPA. Change Order 1 was authorized on July 24,, 2017 for additional shorewell repairs. Change Order 2 was authorized on September 11, 2017 for safety modifications to shorewell ladders. Construction is now 100% complete. Analysis: This Change Order is to document the final completion date and minor changes to the work that were encountered throughout the project. Specific items are detailed in the attached Proposed Change Orders (PCO) which is the result of negotiations between staff, the contractor, and the engineer. These PCO’s are also summarized below, indicating both costs and credits associated with these changes, along with impacts to the completion date. PCO#2 / +$800.00 – Hydrant Protection Pad: The proposed location of a new hydrant needed to be moved because of interference with the existing wash water basin. The move required some additional concrete work to protect the hydrant from vehicles at the water plant. This PCO addresses the additional cost associated with the concrete work. PCO#3 / -$375.00 – Eliminate Pipe Markers: New pipes installed at the water plant are labeled to indicate their purpose. This labeling was included in the original scope of work. To provide more uniform labeling where it is most needed by the operators, City staff completed this task. This PCO deletes the work task from the contract and provides the associated credit. PCO#7 / -$1,500.00 – Influent Conduit Concrete: Concrete placed in the water plant around new interconnection pipes between influent conduits 1 and 2 did not achieve the specified strength after curing. While the consultant engineer concluded that the strength achieved by the concrete is sufficient for its intended purpose, the concrete supplier provided a credit associated with the material. This PCO accounts for that credit. PCO#8 / -$1,520.00 – Hastelloy Pipe Installation Credit: Wall penetrations needed to install the new phosphate feed system were eliminated because existing pipe penetrations were able to be used instead. This PCO provides the credit associated with the elimination of that work. PCO#9 / -$3,500.00 – Engineer Office Trailer: A temporary office space for the resident engineer was to be provided by the Contractor during construction. Instead, the engineer used available office space at the water plant. This PCO 173 of 549 provides the contractor’s credit associated with the elimination of the temporary office space. PCO#10 / -$2,547.50 – Concrete Repair Final Quantity: Some concrete repair work required at the shore wells was slightly less than shown in the original design. This PCO provides a credit for the unused quantities. PCO#11 / -$4,304.94 – Electrician Credits: Some conduits shown in the original design were not needed and a different, but acceptable, type of wire was installed than specified for some runs. This PCO provides a credit these items. PCO#12 / +$1,500.00 – Revised Pipe Support: The pipe support originally designed for the new 30-inch filter washwater influent piping could not be installed due to localized deterioration of existing concrete. The support could not be moved, so the Contractor and Engineer developed a new support system. This PCO addresses the additional material and labor costs associated with the new pipe support. PCO#13 / +$5,332.00 – Additional Yard Piping: Extra work and materials were required to install new yard piping under the parking lot due to field conditions that were discovered once construction began, including pipe located deeper than expected and unknown buried obstructions. This PCO addresses additional time and material needed to respond to the unexpected conditions. PCO#14 / +$1,414.00 – Carrier Pipe Obstructions: Extra work and materials were required to install a new carrier pipe under the parking lot due to obstructions that were encountered once construction began. This PCO addresses additional time and material needed to respond to the unexpected conditions. PCO#15 / -2,080.00 – Pump Assistance: Four instances were documented where City staff provided support to the contractor beyond the normal partnering that lead to the successful completion of this project. The City provided a pump to dewater influent conduits, City staff lent support during a critical phase of dewatering for construction of the new valve vault, and the City twice responded to the flooding of existing vaults before the contractor could arrive on site. This PCO provides credit associated with these items. PCO#16 / +1,980.00 – Valve Replacement Water: During installation of new equipment on the 30-inch filter washwater influent piping, the piping could not be isolated and drained as completely as expected. This caused delay to the Contractor during critical shut-down periods. Rather than leaving the site and returning once the conditions improved, the Contractor stayed on site to resume work as soon as possible to minimize the shutdown period. This PCO addresses the additional labor needed to complete the work. PCO#17 / +270.00 – ARV Piping Change: The routing of discharge piping for discharge from three new Air Relief Valves was changed from the original plans. This PCO addresses the labor and material associated with that change. 174 of 549 PCO#18 / $0.00 – Schedule: Work throughout the project progressed well and the Contractor demonstrated a commitment to complete the work on time. However, delays from the metals fabricator during the final phases of the work resulted in a delay of the final completion date of 19 days. This PCO addresses this final delay. This change order results in a reduction to the current Contract Cost. Funding for this Project is from the Water Fund, Account 513.71.7330.65515 – 733094. A summary of the funding for this overall project is shown on the table below. Item Account Summary 513.71.7330.62140-733094 Budgeted Amount $2,500,000.00 (Multi-Year Budget) Engineering Agreement Design and Construction $475,381.00 Construction Agreement Original amount $1,247,000.00 Construction Change Order No. 1 Shorewell Improvements $35,611.00 Construction Change Order No. 2 Ladder Rungs $7,110.00 Construction Change Order No. 3 Close-Out (Under Consideration) $4,531.44 (Credit) Account Balance $739,604.44 Legislative History: The City Council approved contract award for construction to TCI on July 11, 2016. The City Council approved Construction Change Order No. 1 with TCI on July 24, 2017. The City Council approved Construction Change Order No 2 with TCI on September 11, 2017 Attachments: Construction Change Order No. 3 Includes Proposed Change Orders from TCI 175 of 549 176 of 549 177 of 549 178 of 549 179 of 549 180 of 549 181 of 549 182 of 549 183 of 549 184 of 549 185 of 549 186 of 549 187 of 549 188 of 549 189 of 549 190 of 549 191 of 549 192 of 549 193 of 549 194 of 549 195 of 549 196 of 549 197 of 549 198 of 549 199 of 549 200 of 549 201 of 549 202 of 549 203 of 549 204 of 549 205 of 549 206 of 549 207 of 549 208 of 549 For City Council meeting of February 12, 2018 Item A3.14 Business of the City by Motion: Change Order – Dempster St Office Renovations For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Lara Biggs, Capital Planning and Engineering Bureau Chief Stefanie Levine, Senior Project Manager Shane Cary, Architect/Project Manager Subject: Change Order to Contract for Dempster Beach Office Renovations (Bid No. 17-40) Date: February 12, 2018 Recommended Action: Staff recommends City Council authorize the City Manager to execute Change Order 5 to the Dempster Beach Office Renovations contract (Bid No. 17-40) with Structures Construction LLC (2300 W. Diversey Avenue, Chicago, IL) in the amount of $4,830. This will increase the overall contract amount from $276,319 to $281,149. There is no time extension associated with this change order. Funding Source: Funding will be provided from the Capital Improvement Program 2017 General Obligation Bonds, which has a budget of $300,000 for this project (Account No. 415.40.4117.65515 – 617015). Livability Benefits: Built Environment: Enhance public Spaces Address indoor and outdoor air quality and light pollution Climate & Energy: Improve energy and water efficiency Education, Arts & Community: Preserve and reuse historic structures and sites Health & Safety: Promote healthy, active lifestyles Memorandum 209 of 549 Background Information: On August 14, 2017, the City Council approved award of the Dempster Beach House Renovations to Structures Construction in the amount of $249,297. This included a $20,000 allowance for changes due to unforeseen conditions. On December 11, 2017, the City Council approved a Change Order to the contract in the amount of $12,427. A brief description of the previously approved change orders follows: Change Order #1 – Lintel and Trim Replacement Around Windows. This change order was authorized by staff on 9/18/2017. It included the replacement of the existing lintels over the windows and deteriorated wood trim. The overall cost of $9,223 was included in the contract allowance of $20,000 and did not change the overall contract price of $249,247. Change Order #2 – Replace Additional Deteriorated Masonry. This change order was authorized by staff on 9/28/2017. The amount of masonry area needing repair increased beyond the base amount included in the contract once the pressure washing and a detailed inspection was completed. The overall cost of $13,530 was partially included in the contract allowance, but required an overall contract price increase of $3,663, increasing the contract cost from $249,247 to $252,960. Change Order #3 – Additional Masonry Repair and Fixture Modifications. This change order was authorized by the City Manager on 11/1/17. It included some additional masonry/joint repairs as well as plumbing modifications necessary to accommodate the new toilet installation. The overall cost of $10,932 increased the contract cost from $252,960 to $263,892. This also included a time extension of 15 days, changing the contract completion date from 12/15/17 to 12/31/17. Change Order #4 – Structural Reinforcing for Ceiling and Roof. This change order was approved by Council on 12/11/17. It included installation of steel beams to support the ceiling and roof, a structural lintel for the ticket window, and a credit for gravel base under the pavement. The overall cost of $12,427 increased the contract cost from $263,892 to $276,319. This also included a time extension of 31 days, changing the contract completion date from 12/31/17 to 1/31/18. Analysis: Staff recommends approval of Change Order No. 5 to increase the contract for the work at the Dempster Beach Office Renovations. Previous change orders approved the installation of steel beams to increase the structural support of the ceiling and roof. During construction of this, it was discovered that a portion of a masonry structural wall needed to be rebuilt. This was only apparent when the wall finish was removed to install the new steel beams required to support the ceiling. A large portion of the structural wall was missing and other portions were composed of loose masonry units. Reinforcing the structure required more of the wall finish to be removed and for a counter top to be uninstalled and reinstalled. The construction for the Dempster Beach Office Renovation is now substantially complete, and this is the final change to the contract. The cost of making the repairs to the wall is $4,830. There is no time extension associated with this change order. 210 of 549 The project budget, with change orders, is as follows: Item Completion Date/ Calendar Days Project Amount Original Base Contract December 15, 2017 $249,297.00 Change Order #1 0 days $0.00 Change Order #2 0 days $3,663.00 Change Order #3 16 days $10,932.00 Change Order #4 31 days $12,427.00 Revised Contract from previous Change Orders January 31, 2018 $276,319.00 Change Order #5 0 days $4,830.00 Revised Contract Amount including this Change Order January 31, 2018 $281,149.00 Total Construction Budget $300,000.00 Legislative History: On August 14, 2017, City Council approved award of the original contract for the Dempster Beach Office Renovations. (Bid No. 17-40) On December 11, 2017, City Council approved Change Order No. 4 to the contract in the amount of $12,427. Attachments: Change Order Request (numbered No. 6 but relates to the Change Order No. 5) Change Order Form 211 of 549 Structures Construction LLC 1251 N Lake Shore Blvd., Evanston, IL A/E: City of Evanston Issue for bid on 8/10/17 Sr. No.Discipline Unit Cost Per Qty.Subtotal Division Total 1 Remove and reinstall countertop, framing and drywall to finish the masonry repair for the new structural support beams (paint not included)$2,300 Estimate $2,326 Remove and reinstall contertop_L $76 Hr 10 $760 Remove and reinstall necessary framing and drywall_L $76 Hr 16 $1,216 Material $350 Ea.1 $350 Actual Remove and reinstall contertop_L $76 Hr 6 $456 $2,300 Remove and reinstall necessary framing and drywall_L $76 Hr 11 $836 Taping and mudding of the drywall_L $76 Hr 8 $608 Material $400 Ea.1 $400 2 Carefully demolish loose clay brick/ CMU wall to rebuild reinforced CMU block piers for the new steel beams.$1,900 Estimate $2,650 Remove masonry wall section and build the masonry piers $75 Hr 30 $2,250 Material $400 Ea.1 $400 Actual Remove masonry wall section and build the masonry piers $75 Hr 20 $1,500 $1,900 Material $400 Ea.1 $400 4,200$ O/H & P 630$ Total CO # 6 : $ 4,830 CO # 6_Beach Office Renovation - 12/12/17 Rev. 1/12/18 to apply Based on existing condition 212 of 549 CITY OF EVANSTON CHANGE ORDER Order No. 005 Date: 02/12/2018 Agreement Date: 8/16/17 PROJECT: Dempster Beach Office Renovations 17-40 OWNER: City of Evanston CONTRACTOR: Structures Construction The following changes are hereby made to the AGREEMENT: 1. Remove and reinstall countertop, framing and drywall to finish the masonry repair for the new structural support beams (paint not included) Add $2,300.00 2. Demolish loose clay brick/ CMU wall to rebuild reinforced CMU block piers. Add $1,900.00 3. Overhead & Profit Add $630.00 Total Change $ $4,830.00 Change to CONTRACT PRICE: $4,830.00 Original BASE CONTRACT PRICE: $ 229,297.00 Original ALLOWANCE $ 20,000.00 Original TOTAL CONTRACT PRICE: $ 249,297.00 Current CONTRACT PRICE adjusted by previous CHANGE ORDERS $ 276,319.00 Total change in CONTRACT PRICE for this CHANGE ORDER $ 4,830.00 The CONTRACT PRICE including this CHANGE ORDER will be $ 281,149.00 Original Date for Contract Completion 12/15/2017 Date for Contract Completion from previous Change Orders 01/31/2017 Time Extension for this Change Order (in calendar days) 0 Days Modified Date for Contract Completion 1/31/2018 Approved by (Owner): City of Evanston Date Accepted by (Contractor): [Structures Construction, LLC] Date 1/23/18 213 of 549 For City Council meeting of February 12, 2018 Item A3.15 Business of the City by Motion: Church Street South Pier Reconstruction For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David Stoneback, Public Works Agency Director Lara Biggs, Bureau Chief – Capital Planning / City Engineer Stefanie Levine, Senior Project Manager Shane Cary, Architect/Project Manager Subject: Church Street South Pier Reconstruction Date: February 12, 2018 Action: Staff recommends that City Council authorize the City Manager to execute Change Order No. 2 with SmithGroup JJR (35 E. Wacker, Suite 2200, Illinois, 60601), for Engineering Services for the Church Street South Pier Reconstruction Project (RFP 16- 13) in the amount of $8,000. This change order increases the contract amount from $90,500.00 to $98,500.00 and extends the contract deadline by 455 days, from December 31, 2017 to March 31, 2019. Funding Source: Funding will be provided from the Capital Improvement Program 2018 General Obligation Bonds (Account 415.40.4118.62145 – 418017). This project was budgeted at $625,000 in FY 2018. Livability Benefits: Built Environment: Enhance public spaces and manage water resources responsibly Health & Safety: Promote healthy, active lifestyles Improve emergency prevention and response Background Information: The Church Street Harbor, located along Evanston’s lakefront just east of Church Street, is used by season permit holders, Recreation Division programs, lakefront rescue operations, the US Coast Guard and Conservation Police for launch of trailered power boats, sailboats and personal watercraft from May to October. On April 25, 2016 City Council approved award of the engineering services to reconstruct the southern pier at Church Street Harbor. This reconstruction will improve the performance of the harbor and decrease the amount of maintenance dredging required. Memorandum 214 of 549 There has been one change order previously approved for this contract. This was for testing of the sediment around the pier which was required by the Illinois Environmental Protection Agency (IEPA). The testing cost an additional $10,500. Analysis: SmithGroup JJR is currently working toward getting the necessary permits for the Church Street South Pier Reconstruction. The IEPA has placed limitations on the area of the lake that can be impacted by the construction and limitations on how to dispose of material dredged from the lakebed during construction. These limitations have increased the estimated cost of the construction. This increased cost can be mitigated by changing the type of structural foundation used to construct the pier. This change order is to compensate SmithGroup JJR for design services associated with adjusting the structural foundation. This work will include changing the drawings, revising calculations, and communicating the changes to all of the agencies that review the drawings and issue a permit for the work. Due to the time required for the ongoing discussions with the IEPA, construction of this project has been delayed from Fall 2017 to Fall 2018. The project budget, with change orders, is as follows: Item Completion Date/ Calendar Days Project Amount Original Base Contract December 31, 2017 $80,000.00 Change Order #1 0 days $10,500.00 Revised Contract from previous Change Orders December 31, 2017 $90,500.00 Change Order #2 455 days $8,000.00 Revised Contract Amount including this Change Order March 31, 2019 $98,500.00 Total Construction Budget $625,000.00 Legislative History: On 04/25/2016, City Council approved award of the Engineering Services to SmithGroup JJR. Attachments: Change Order Request No. 2 215 of 549 216 of 549 217 of 549 For City Council meeting of February 12, 2018 Item A4 Resolution 9-R-18: Memorandum of Understanding Between City and MGNWC For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: W. Grant Farrar, Corporation Counsel Subject: Resolution 9-R-18, Authorizing the Execution and Approval of A Memorandum of Understanding between the City and the Morton Grove/Niles Water Commission Date: February 12, 2018 Recommended Action: Staff recommends City Council adoption of Resolution 9-R-18, authorizing the approval and execution of the attached Memorandum of Understanding (MOU) between the City of Evanston and the Morton Grove-Niles Water Commission (MGNWC) for the construction and operation of an intermediate booster pump station located at 2525 Church Street. Livability Benefits: Innovation & Process: Support local government best practices and processes. Summary: Following the execution in 2017 of the City of Evanston water supply agreement with new wholesale water customers, the Villages of Niles and Morton Grove, the 2 villages formed a water commission to assume the rights and obligations of Niles and Morton Grove. The new entity is called the Morton Grove-Niles Water Commission. The MGNWC Water System will consist of water transmission mains, an intermediate pump station, the Nagle pump station, a standpipe and other related infrastructure to transport water from the Evanston Water System at a point near the intersection of Emerson Street and McCormick Boulevard (‘the Connection Point”) to the Villages. A critical component of the MGNWC Water System is an intermediate pumping station (“IPS”) which must be constructed and operated within 5,000 feet of the Connection Point. The MGNWC has determined that the IPS can be located in Evanston on a 2.58- acre parcel of property located north of Church Street, east of the North Shore Channel, south of Beck Park and west of McDaniel Avenue commonly known as 2525 Church Street, Evanston, Illinois (the “Shore Property”). The Shore Property is owned by the Metropolitan Water Reclamation District of Greater Chicago (“MWRDGC”) and leased by Evanston; and Memorandum 218 of 549 Evanston intends to develop the Shore Property with the grading of an athletic field and the construction of a splash pad, picnic shelter, public rest rooms, and parking lot. MGNWC will contract and pay for engineering services and construction work to demolish and remove the existing school building and north parking lot from the Shore Property. MGNWC is solely responsible for the means and methods of this work. Evanston will reimburse MGNWC for its reasonable costs associated with this work, which at this time are $12,160. The south parking lot will remain in its existing state until the park improvements are constructed by Evanston. MGNWC will at its expense, install code compliant electrical and the plumbing connections and fixtures for the bathrooms and will make provisions such as floor openings and ducts for the future completion of the piping needed for the splash pad mechanical equipment. Drains and plumbing waste connections in the restrooms will be connected to the IPS wastewater removal system which will consist of a grinder pump station. MGNWC is solely responsible for the means and methods of this work. Evanston will reimburse the MGNWC for the cost to purchase and install the bathroom fixtures. Evanston intends to construct the park improvements at some time in the near future. Evanston will provide the water supply and the electrical power needed for the bathrooms, splash pad mechanical room, and site lighting. Approval of the proposed MOU will ensure the City’s anticipated delivery of wholesale water to new customer MGNWC stays on schedule commencing at the beginning of 2019. Attachments: Resolution 9-R-18 and MOU Beck Park Expansion – Concept Plan/Map 219 of 549 2/6/2018 9-R-18 A RESOLUTION AUTHORIZING THE APPROVAL AND EXECUTION OF A MEMORANDUM OF UNDERSTANDING BETWEEN THE CITY OF EVANSTON AND THE MORTON GROVE-NILES WATER COMMISSION FOR THE CONSTRUCTION AND OPERATION OF AN INTERMEDIATE BOOSTER PUMP STATION LOCATED AT 2525 CHURCH STREET WHEREAS, in 2017, the corporate authorities of the City of Evanston (“Evanston”), the Village of Morton Grove (“Morton Grove”) and the Village of Niles (“Niles”) each adopted an ordinance or resolution that authorized the approval and execution of an agreement entitled “Water Supply Agreement Between The City Of Evanston And The Village Of Morton Grove And The Village Of Niles” (the “Water Supply Agreement”). The respective ordinance and resolutions approving the Water Supply Agreement are identified as follows: Evanston approved Ordinance Number 5- O-17 on February 13, 2017; Morton Grove approved Resolution Number 17-03 on January 23, 2017; and Niles approved Resolution Number 2017-02R on January 24, 2017; and WHEREAS, after the approval of the Water Supply Agreement, the Morton Grove-Niles Water Commission (“MGNWC” or “Commission”) was established by an intergovernmental agreement approved by Morton Grove and Niles by the adoption of ordinances pursuant to Division 135 of Article 11 of the Illinois Municipal Code (65 ILCS 5/11-135-1, et seq.) (“Division 135”), Article VII, Section 10 of the 1970 Constitution of the State of Illinois, and the Illinois Intergovernmental Cooperation Act (5 ILCS 220/1, et seq.) for purposes of constructing and operating a public water supply 220 of 549 9-R-18 system (the "MGNWC System") consisting of water transmission mains, pumping, storage, and other related water delivery and receiving infrastructure between a connection point on the Evanston water system and existing water receiving points of Niles and Morton Grove (the “Project”); and WHEREAS, the MGNWC determined that the IPS can be located in Evanston on a 2.58-acre parcel of property located north of Church Street, east of the North Shore Channel, south of Beck Park and west of McDaniel Avenue commonly known as 2525 Church Street, Evanston, Illinois (the “Shore Property”). The Shore Property is owned by the Metropolitan Water Reclamation District of Greater Chicago (“MWRDGC”) and leased by Evanston. Evanston and the MGNWC determined it is necessary to enter into a Memorandum of Understanding (“MOU”) regarding the IPS construction and operation; and WHEREAS, Evanston intends to develop the Shore Property with the grading of an athletic field and the construction of a splash pad, picnic shelter, public rest rooms, and parking lot (“Evanston Improvements”). The Evanston Improvements will require the demolition of the existing school building and north parking lot; and expansion of the existing south parking lot. These uses and activities to be performed by Evanston, and all actions to be performed by Evanston pursuant to this MOU, were otherwise approved as more fully set forth in Ordinance 2-O-18, previously approved by the Evanston City Council; and WHEREAS, subject to the approval of the MWRDGC, Evanston and the MGNWC have agreed that the IPS shall be constructed and operated on the Shore Property in accordance with the terms and conditions of this MOU; and 221 of 549 9-R-18 WHEREAS, the Mayor and City Council of the City of Evanston have the authority to enter into this MOU pursuant to Evanston’s home rule powers as provided by Article VII, Section 10 of the 1970 Constitution of the State of Illinois, the Illinois Intergovernmental Cooperation Act (5 ILCS 220/1, et seq.) and the Illinois Municipal Code (65 ILCS 5/1, et seq.), and the City Council finds that approving and entering into the MOU is in the best interests of the City of Evanston. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: SECTION 1: Each Whereas paragraph above is incorporated by reference into this Section 1 and made a part hereof as material and operative provisions of this Resolution. SECTION 2: The City Council of the City of Evanston authorizes the approval of the attached form of an agreement entitled “MEMORANDUM OF UNDERSTANDING BETWEEN THE CITY OF EVANSTON AND THE MORTON GROVE-NILES WATER COMMISSION FOR THE CONSTRUCTION AND OPERATION OF AN INTERMEDIATE BOOSTER PUMP STATION ON PROPERTY COMMONLY ADDRESSED AS 2525 CHURCH STREET, EVANSTON IL. ON MWRDGC PROPERTY”, attached hereto as Exhibit “A”. The City Council of the City of Evanston authorizes and directs the City Manager to execute the MOU in a form approved by the Corporation Counsel, and to execute and deliver all other instruments and documents and pay all costs that are necessary to fulfill Evanston’s obligations 222 of 549 9-R-18 under the MOU. This includes reimbursing MGNWC $12,160 for demolition of the Shore Property and related activities, as provided for in Section 6 of the MOU. SECTION 3: This Resolution 9-R-18 shall be in full force and effect from and after its passage and approval in the manner provided by law. _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Adopted: February 12, 2018 Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 223 of 549 9-R-18 Exhibit “A” MEMORANDUM OF UNDERSTANDING BETWEEN THE CITY OF EVANSTON AND THE MORTON GROVE-NILES WATER COMMISSION FOR THE CONSTRUCTION AND OPERATION OF AN INTERMEDIATE BOOSTER PUMP STATION ON PROPERTY COMMONLY ADDRESSED AS 2525 CHURCH STREET, EVANSTON IL. ON MWRDGC PROPERTY 224 of 549 225 of 549 226 of 549 227 of 549 228 of 549 229 of 549 230 of 549 231 of 549 232 of 549 233 of 549 234 of 549 235 of 549 236 of 549 237 of 549 238 of 549 CHURCH STREET McDANIEL AVENUEATHLETIC FIELD PARKING LOT SPLASH PARKNORTH SHORE CHANNELBECK PARK LELAND AVENUELYONS STREET PUMP HOUSEAND RESTROOMBECK PARK EXPANSION - CONCEPT PLAN JANUARY 18, 2018 NORTH 1"= 100'=0" 239 of 549 For City Council meeting of February 12, 2018 Item A5 Resolution 2-R-18: Approving Release of Closed Session Minutes For Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee City Manager, Wally Bobkiewicz From: W. Grant Farrar, Corporation Counsel Subject: Resolution 2-R-18, Approving Release of Certain Closed Session Minutes Date: February 1, 2018 Recommended Action: Staff recommends City Council approval of Resolution 2-R-18, releasing the closed session meeting minutes listed on Exhibit A and finding that a need still exists for confidentiality as to the minutes on Exhibit B. The City is furthering its efforts to provide access to information and openness in government through the appropriate release of closed session minutes of the City Council. Livability Benefit: Equity & Empowerment: provide for meaningful community engagement Summary: The Open Meetings Act, 5 ILCS 120/1, et seq., provides for specific exceptions to the general requirement of the Act that all meetings of public bodies be open, all actions of public bodies be taken openly, and all deliberations of public bodies be conducted openly (5 ILCS 120/1). Section 2.06 of the Open Meetings Act requires the City Council to meet and determine whether the need for confidentiality still exists as to closed session minutes. The schedule of closed session minutes on Exhibit A, in whole or in part, no longer necessitates confidential treatment and should be made available for public inspection which includes a total of 16 closed session minutes. The schedule of closed session minutes listed on Exhibit B still requires confidentiality for a variety of reasons provided for within the Open Meetings Act exceptions, 5 ILCS 120/2, including matters of personnel, collective bargaining and pending litigation matters. ------------------------------------------------------------------------------------- Attachments: Resolution 2-R-18 Memorandum 240 of 549 2/1/2018 2-R-18 A RESOLUTION TO RELEASE CITY COUNCIL CLOSED SESSION MINUTES WHEREAS, the City Council has met from time to time in executive session for purposes authorized by the Illinois Open Meetings Act (5 ILCS 120/1 et seq); and WHEREAS, the Open Meetings Act requires a semi-annual review by the public body of all closed session minutes (5 ILCS 120/2.06(c)); and WHEREAS, pursuant to the requirements of the Illinois Open Meetings Act, (5 ILCS 120/2.06(c)), the City Council met to review minutes of all closed session meetings and make a determination and report in open session that (1) the need for confidentiality still exists as to all or part of those minutes; or (2) that the minutes or portions thereof no longer require confidentiality and should be made available for public inspection; and WHEREAS, the City Council has determined that the schedule of minutes of closed session meetings attached hereto as Exhibit “A” no longer require confidential treatment, in whole or in part and the City Council has found that portions of the minutes to be released should be redacted for confidential treatment; and WHEREAS, the City Council has determined that the schedule of minutes of closed session meetings attached hereto as Exhibit “B” still require confidential treatment and will not be made available for public inspection at this time, pursuant to Section 2.06 of the Open Meetings Act, NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: 241 of 549 2-R-18 - 2 - SECTION 1: The foregoing recitals are hereby found as fact and incorporated herein by reference. SECTION 2: The executive session minutes from those meetings set forth on Exhibit A attached hereto are hereby released. SECTION 3: The City Clerk is hereby authorized and directed to make said minutes available for posting on the City of Evanston’s website, for inspection and copying in accordance with the standing procedures of the Clerk’s office. SECTION 4: That this Resolution 2-R-18 shall be in full force and effect from and after its passage and approval in the manner provided by law. _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Adopted: __________________, 2018 Approved as to form: _______________________________ W. Grant Farrar, Corporation Counsel 242 of 549 2-R-18 - 3 - EXHIBIT A SCHEDULE OF CLOSED SESSION MINUTES TO BE RELEASED Date 2017 1/9/17 2/13/17 (partial) 4/24/17 (partial) 2016 1/25/16 2/8/16 3/14/16 5/9/16 6/13/16 6/20/16 7/11/16 9/12/16 9/26/16 11/28/16 2015 2/9/15 8/17/15 2014 9/8/14 243 of 549 2-R-18 - 4 - EXHIBIT B SCHEDULE OF CLOSED SESSION MINUTES NOT ELIGIBLE FOR RELEASE DUE TO A NEED FOR CONFIDENTIALITY AS OF FEBRUARY 12, 2018: Date Hold in whole or in part 2017 2/13/17 HOLD in part 4/17/17 HOLD 4/24/17 HOLD in part 5/2/17 HOLD 5/15/17 HOLD 6/12/17 HOLD 6/26/17 HOLD 7/24/17 HOLD 8/14/17 HOLD 9/6/17 HOLD 9/11/17 HOLD 9/18/17 HOLD 10/2/17 HOLD 10/16/17 HOLD 11/13/17 HOLD 11/27/17 HOLD 2016 9/19/16 HOLD 2015 1/5/15 HOLD in part 1/12/15 HOLD in part 7/27/15 HOLD in part 8/10/15 HOLD in part 8/12/15 HOLD 2014 8/12/14 HOLD 9/15/14 HOLD in part 12/8/14 HOLD in part 2013 3/11/13 HOLD in part 6/10/13 HOLD in part 2011 3/22/11 HOLD in part 244 of 549 For City Council meeting of February 12, 2018 Items A6 and A7 Resolution 6-R-18, Appointment of an Interim Chief Financial Officer Ordinance 19-O-18, Updating Authorized Signatories for Deposits/Investments Resolution: For Action / Ordinance: For Introduction To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: Ashley King, Interim Chief Financial Officer/City Treasurer Subject: Appointment of Interim CFO/Treasurer Date: February 12, 2018 Recommended Action: Staff recommends City Council adopt Resolution 6-R-18, appointing Ashley King as Interim Chief Financial Officer and Interim Treasurer. In addition, staff recommends City Council adopt Ordinance 19-O-18, adding Ashley King, Budget Manager and Interim Chief Financial Officer/Treasurer, and Andrew Villamin, Accounting Manager, as a depository signature. Livability Benefits: Innovation & Process: Support local government best practices and processes Summary: With the departure of CFO/Treasurer Martin Lyons in early January, Ashley King was appointed to act in his role until a permanent CFO could be hired. As such, the attached documents must be updated: 1. Resolution 6-R-18 appoints Ms. King as City Treasurer 2. Ordinance 19-O-18 adds Ms. King and Mr. Andrew Villamin, the City’s Accounting Manager, to the City’s accounts. Attachments: Resolution 6-R-18 Ordinance 19-O-18 Memorandum 245 of 549 1/26/2018 6-R-18 A RESOLUTION Authorizing the Appointment of an Interim Chief Financial Officer and Interim Treasurer for the City of Evanston WHEREAS, the position of Chief Financial Officer and Treasurer is currently vacant in the City of Evanston and the City is currently in the process of searching for its Chief Financial Officer and Treasurer; and WHEREAS, Ashley King is the City of Evanston Budget Manager and an authorized signatory for City of Evanston financial accounts and keeps the financial books and records of the City, which is authorized by Ordinance 19-O-18 adopted on February 12, 2018; and WHEREAS, it is in the best interest of the City of Evanston to appoint an Interim Chief Financial Officer and Interim Treasurer to handle the City’s financial responsibilities in the absence of the Chief Financial Officer and Treasurer; and WHEREAS, it is necessary and in the best interest of the City to empower an Interim Chief Financial Officer and Interim Treasurer to keep the financial books and records, sign checks and withdraw or transfer funds in the absence of a Chief Financial Officer and Treasurer, NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Budget Manager, Ashley King, shall be appointed Interim Chief Financial Officer and Interim Treasurer to perform both the Chief Financial Officer and Treasurer functions and duties due to the positions’ vacancies. 246 of 549 6-R-18 ~ 2 ~ SECTION 2: Ashley King will be authorized to keep the financial books and records of the City, withdraw or transfer funds and to sign checks drawn on the City. SECTION 3: The foregoing recitals are hereby found as fact and incorporated herein by reference. SECTION 4: Resolution 6-R-18 shall be in full force and effect from and after the date of its passage and approval in the manner provided by law. _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Adopted: __________________, 2018 247 of 549 1/26/2018 19-O-18 AN ORDINANCE Updating Authorized Signatories and Financial Institutions for Deposits/Investments of City Funds WHEREAS, the City of Evanston (hereinafter, the “City”), located in Cook County, Illinois, is a home rule unit of government under the provisions of Article 7 of the 1970 Constitution of the State of Illinois, can exercise any power and perform any function pertaining to its government affairs, including but not limited to the power to tax and incur debt; and WHEREAS, pursuant to 65 ILCS 5/3.1-35-50, the municipal treasurer is authorized to deposit all funds and money belonging to the City in depositories designated by ordinance of the corporate authorities; and WHEREAS, the City of Evanston, Cook County, Illinois maintains its savings, checking, and investment accounts at various institutions; and WHEREAS, it is necessary and appropriate for the City Council to approve by ordinance those financial institutions and brokers with whom the City is authorized to invest, and those City employees authorized by the City Council as signatories on various City financial institution accounts. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: SECTION 1: That the foregoing recitals are found as fact and made a part hereof. 248 of 549 19-O-18 ~2~ SECTION 2: The following individuals may be authorized signatories on various City financial institution accounts: Wally Bobkiewicz, City Manager Ashley King, Interim CFO/Treasurer Andrew Villamin, Accounting Manager SECTION 3: Authorized City staff may invest City non-fiduciary funds with the following financial institutions and/or brokers: JP Morgan Chase 1st Bank of Evanston PMA Financial Network, Inc. Byline Bank Zions First National Bank US Bank The Vanguard Group Wells Fargo MB Financial BMO Harris Illinois Metropolitan Investment Fund Illinois Funds SECTION 4: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 5: If any provision of Ordinance 19-O-18 or application thereof to any person or circumstance is held unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this Ordinance that can be given effect without the invalid application or provision, and each invalid application of this Ordinance is severable. SECTION 6: Ordinance 19-O-18 shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. 249 of 549 19-O-18 ~3~ Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: ________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk 250 of 549 For City Council Meeting of February 12, 2018 Item A8 Ordinance 20-O-18: One-Way Traffic Flow on Hurd & Central Park Adjacent to Willard School For Introduction To: Honorable Mayor and Members of the City Council Members of the Administration & Public Works Committee From: Erika Storlie, Assistant City Manager Lara Biggs, P.E., Bureau Chief – Capital Planning / City Engineer Rajeev Dahal, Senior Project Manager - Transportation Subject: Ordinance 20-O-18, Amending City Code to Allow for One-Way Traffic Flow during Willard School Drop-Off and Pick-Up Hours on Hurd Street and Central Park Avenue Date: January 25, 2018 Recommended Action: Staff recommends City Council adoption of Ordinance 20-O-18, amending City Code Section 10-11-4, Schedule IV (A) to establish one-way south traffic on Hurd Street between Isabella Street and Park Place, and one-way north traffic on Central Park Avenue between Park Place and Isabella Street adjacent to Willard Elementary School during drop-off and pick-up hours. Funding Source: Funding for signage will be through the General Fund-Traffic Control Supplies (Account 100.40.4520.65115), with a FY 2018 budget of $58,000. Livability Benefits: Built Environment: enhance public spaces and provide complete streets Health & Safety: improve emergency prevention and response Summary: Alderman Suffredin, Willard School Principal, area residents, School District 65 and City staff attended a meeting at the school on January 17, 2018 to discuss congestion and safety concerns on Hurd Street and Central Park Avenue during the school arrival and Memorandum 251 of 549 dismissal periods. Based on the discussions at the meeting and in an attempt to reduce congestion and increase safety of school children in the vicinity of Willard School, staff is recommending one-way traffic flow on Hurd Street and Central Park Avenue. Traffic on Hurd Street will be allowed only in the southbound direction and traffic on Central Park will be allowed only in the northbound direction during the during Willard School arrival and dismissal periods. This traffic technique has been used at other schools in the City to improve circulation and address congestion/safety concerns. Attachment: Ordinance 20-O-18 252 of 549 1/25/2018 20-O-18 AN ORDINANCE Amending Schedule IV(A), “ One-Way Streets,” of City Code Section 10-11-4(A), to Include Portions of Hurd Avenue and Central Park Avenue During Willard Elementary School Drop-Off and Pick-Up Hours NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: SECTION 1: Schedule IV(A), “One-Way Streets,” of Section 10-11- 4(A), of the Evanston City Code of 2012, as amended, is hereby further amended to include the following: Hurd Avenue – Isabella Street to Park Place during Willard Elementary School Drop-Off and Pick-Up hours South Only Central Park Avenue – Park Place to Isabella Street during Willard Elementary School Drop-off and Pick-Up hours North Only SECTION 2: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Complied Statues and the courts of the State of Illinois. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: This ordinance will be in full force and effect from and after its passage, approval and publication in the manner provided by law. 253 of 549 ~2~ SECTION 5: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications, and each invalid provision or invalid application of this ordinance is severable. Introduced:_________________, 2018 Adopted:___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid City Clerk Approved as to form: ______________________________ Grant Farrar Corporation Counsel 254 of 549 For City Council meeting of February 12, 2018 Item A9 Ordinance 9-O-18: Vehicle Permits for Excessive Weight and Size For Introduction & Action To: Honorable Mayor and Members of the City Council Members of the Administration and Public Works Committee From: David D. Stoneback, Public Works Agency Director Rajeev Dahal, Senior Project Manager - Transportation Subject: Ordinance 9-O-18, Amending City Code Section 10-1-9-4 Vehicle Permits for Excessive Weight and Size Date: February 1, 2018 Recommended Action: Staff recommends that City Council adopt Ordinance 9-O-18, amending Section 10-1-9- 4, of the City Code to establish permits and applicable fees for excessive vehicle weight and size in accordance with limitations set forth in 625-ILCS 5/15 -100 of the Illinois Vehicle Code. Staff recommends suspension of rules for Introduction and Action of this Ordinance at the February 12, 2018 City Council meeting. Revenue Source: Revenue from the permit fees, estimated to generate $15,000 - $20,000 revenue per year will be applied to the Oversize Truck Permit Account 100.40.4105.52140. Livability Benefits: Built Environment: enhance public spaces Health & Safety: improve emergency prevention and response Summary: Per State Law, a permit is required to operate or move any vehicle or combination of vehicles upon any street that exceeds the maximum weight, height, or length limitations set forth in 625 ILCS 5/15-100 of the Illinois Vehicle Code. Staff currently issues approximately 250 permits per year over the phone to applicants upon verifying their State permit, destination and routing information. Currently, the City does not charge any fees for such permits. Excessive weight vehicles traveling on established truck routes can cause distress to the pavement conditions overtime causing more Memorandum 255 of 549 maintenance requirements. This amended ordinance includes a fee schedule for granting such permits as follows: Weight (With Load) Single Trip * Round Trip ** Up to 100,000 lbs. $75.00 $150.00 100,001 – 120,000 lbs. $100.00 $200.00 120,001 – 150,000 lbs. $125.00 $250.00 Over 150,000 lbs. $150.00 $300.00 Excessive size fee will be $50.00 for single trip permit and $100.00 for round trip permit. A $25 fee will be assessed for a permit to move an excessive weight vehicle from a point of origin and final destination within the City limits. Any vehicle that violates the provisions of the ordinance can be fined five hundred dollars ($500). Attachment: Ordinance 9-O-18 256 of 549 1/18/2018 9-O-18 AN ORDINANCE Amending City Code Section 10-1-9-4, “Permits for Excessive Weight and Size” NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Section 10-1-9-4 of the City Code of 2012 is hereby deleted in its entirety and amended to read as follows: 10-1-9-4. – PERMITS FOR EXCESSIVE WEIGHT AND SIZE. (A) Permit Required. A permit is required to operate or move any vehicle or combination of vehicles upon any street within the City of Evanston that exceeds the maximum weight, width, height, or length limitations set forth in 625 ILCS 5/15-100 et seq. of the Illinois Vehicle Code. (B) Exceptions. No permits shall be required for the following vehicles: 1. Fire Department vehicles; 2. City owned vehicles; 3. Vehicles operating under an emergency declaration; 4. Vehicles used by Utility Companies that have an existing franchise agreement with the City; or 5. Vehicles used by Contractors hired by the City while working on City projects will require a permit; however, the City permit fee will be waived. (C) Application for Excessive Weight and Size Permits. Applications for all excessive weight and size permits shall be submitted in the method and form required by the Public Works Agency Director or his/her designee and shall include at a minimum: a. The type of vehicle; b. The weights and dimensions of the vehicles(s); c. The description of the load; d. The requested route to be taken by the vehicle; e. The destination of the vehicle within the City; and f. The name of the carrier, if different from the Applicant. 257 of 549 9-O-18 ~2~ (D) Upon receipt of a completed application and proof of payment of the fee, the Public Works Agency Director or his/her designee may issue an excessive weight or size permit, subject to the following conditions: 1. In consideration of seasonal or other time limitations, the Public Works Agency Director or his/her designee may restrict the number of daily trips authorized by each permit, as is consistent with public safety. 2. In establishing the routes to be traveled, the Public Works Agency Director or his/her designee may establish the route consistent with public safety, taking into consideration existing traffic, the character of the road or roads and the configuration of the terrain. 3. All permits are nontransferable and will be valid for the Applicant or his agent or employee and the specific vehicle listed on the application. 4. Every permit must be carried in the vehicle in paper or electronic form to which it refers and must be open to inspection by any police officer, or agent of the City. 5. No refunds of the permit fee will be made to the Applicant following permit issuance. 6. The Applicant must comply with all applicable local, state and federal statutes, ordinances, regulations, rules and requirements. 7. Altering or falsifying a permit will revoke the Applicant’s permit privileges for up to twelve (12) months, at the discretion of the Public Works Agency Director. 8. The Public Works Agency Directors or his/her designee is authorized to require police escorts to provide for a safe move. The total number of police officers required will be determined by the Police Department and fees will be assessed pursuant to City Code Section 10-1-9- 4(E)(4). 9. The Public Works Agency Director or his/her designee is authorized to create and amend reasonable provisions for permits. (E) Fee Schedule for Permits. Excessive weight permits for an excessive weight vehicle, including load, may be applied for and may be granted per the fee schedule as set forth in this ordinance. 1. Excessive Weight Fee. Permits for non-divisible excessive weight movements shall be based on the following fee schedule: Excessive Weight Permit Fee Schedule Weight (With Load) Single Trip * Round Trip** Up to 100,000 lbs. $75.00 $150.00 100,001 – 120,000 lbs. $100.00 $200.00 120,001 – 150,000 lbs. $125.00 $250.00 258 of 549 9-O-18 ~3~ Over 150,000 lbs. $150.00 $300.00 *Single trip. Any of the following constitutes a single trip: a. One (1) move from the point of origin from the first point of entry into the City limits to the point of destination within the City limits; b. One (1) move from the point of origin within the City limits to the point of exit outside the City limits; or c. One (1) move from the point of orign from the first point of entry into the City limits to the point of exit outside the City limits. Any additional stops between the point of origin and the point of destination will be assessed an additional Local Operation Fee. Single Trip permits are valid for five (5) days from the requested date and time of issuance. **Round trip. Two (2) trips over the same route in opposite directions using the “Singe trip” methodolo gy above. Any additional stops or interruptions between the point of entry into the City limits and the point of destination (and reverse) will be assessed an additional Local Operation Fee. Round trip permits shall be valid for a period of time not to exceed ten (10) days from the date and time of issuance. 2. Local Operation Fee. A fee of twenty-five dollars ($25.00) will be assessed for a permit to move an excessive weight vehicle from a point of origin within the City limits to a point of destination within the City limits. 3. Re-entry Fee. A fee of twenty-five dollars ($25.00) will be assessed for a permit to re-enter the City limits on a continuous route within twenty-four (24) hours from the original date and time of entry into the City limits. 4. Excessive Size Fee. A fee of fifty dollars ($50.00) will be assessed for a single trip permit and a fee of one hundred dollars ($100.00) will be assessed for a round trip permit. This fee shall be in addition to other required permit fees. Vehicles required to obtain an escort pursuant to 65 ILCS 5/15-102 must do so and comply with all applicable escort requirements. 5. Police Escorts. A fee of two hundred dollars ($200.00) will be assessed per police unit escort per hour. A minimum of two (2) hours will be charged. Subsequent hours will be billed at fifteen (15) minute increments. 259 of 549 9-O-18 ~4~ 6. Revision Fee. A fee of twenty-five dollars ($25.00) will be assessed if the Applicant requests any adjustment or renewal of a previously issued permit. (F) Penalties. Any person who violates the provisions of Section 10-1-9-4 of this Title shall be guilty of an offense punishable by five hundred dollars ($500.00). Each day that such a violation continues shall constitute a separate offense. SECTION 2: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 3: If any provision of this Ordinance 9-O-18 or application thereof to any person or circumstance is held unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this Ordinance that can be given effect without the invalid application or provision, and each invalid application of this Ordinance is severable. SECTION 4: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. SECTION 5: Ordinance 9-O-18 shall be in full force and effect on April 1, 2018, after its passage, approval, and publication in the manner provided by law. Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor 260 of 549 9-O-18 ~5~ Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 261 of 549 For City Council meeting of February 12, 2018 Item A10 Ordinance 10-O-18, Amending City Code to Include Civil Restitution For Introduction To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: W. Grant Farrar, Corporation Counsel Alexandra B. MacKey, Assistant City Attorney Subject: Ordinance 10-O-18, Amending City Code to Include Civil Restitution Date: February 12, 2018 Recommended Action: City staff recommends City Council adoption of Ordinance 10-O-18 to amend City Code Subsection 1-4-1, “General Penalties,” to include civil restitution by order of Court. Livability Benefit Innovation & Process: Support local government best practices and processes. Summary Ordinance 10-O-18 serves to update the general penalties section of the City Code. This ordinance adds civil restitution to the penalties available for City Code violations. Civil restitution may only be ordered by a Court after a finding of guilt or a guilty plea by a defendant. The Illinois Municipal Code mandates that fines issued by a municipality are limited to seven hundred and fifty dollars ($750.00). 65 ILCS 5/1-2-1. This ordinance allows a Court to order restitution beyond the maximum fine amount. Other municipalities, such as, Arlington Heights, Champaign and Schaumburg, have similar civil restitution ordinances to recover loss or damage committed by a defendant. ------------------------------------------------------------------------------------- Attachments: Ordinance 10-O-18 Memorandum 262 of 549 1/4/2018 10-O-18 AN ORDINANCE Amending City Code Section 1-4-1, “General Penalty,” to Include Civil Restitution NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: SECTION 1: City Code Section 1-4-1, “General Penalty,” of the Evanston City Code of 2012, as amended, is hereby further amended to read as follows: 1-4-1. - GENERAL PENALTY. (A) Whenever any provision of this Code or any ordinance of the City: 1) prohibits an act or makes or declares an act unlawful or an offense; or 2) requires an act to be performed or declares the failure to perform an act to be unlawful or an offense, and the Code is silent with respect to the penalty to be imposed upon a finding of liable, the penalty shall be a fine of not less than twenty dollars ($20.00) but not more than seven hundred fifty dollars ($750.00) and/or compliance with or community service orders as specified in Subsection 11-1- 9(F) of this Code. Where applicable, each day a Code provision is found to have been violated shall constitute a separate offense and when the Code is silent as to penalty, each separate offense subjects the violator to the penalty provided for in this Subsection. (B) In addition to any fine imposed under subsection (A) of this section, a violator may be required to pay administrative costs and enforcement costs and may be ordered to cease violating and/or comply with the Code provision(s) found to have been violated and/or ordered to post a compliance bond as provided by Title 11 of this Code. The Manager of the Division of Administrative Adjudication shall establish a uniform schedule of administrative costs and enforcement costs. (C) In addition to any fine imposed under Subsection (A) of this Section, whenever a finding of guilty is entered by the Circuit Court or a plea of guilty is entered by a defendant, the Court may order a defendant to pay restitution . The Court will determine the amount and conditions of the restitution payment . 263 of 549 10-O-18 ~2~ SECTION 2: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and will be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: This ordinance will be in full force and effect from and after its passage, approval and publication in the manner provided by law. SECTION 5: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity will not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 264 of 549 For City Council meeting of February 12, 2018 Item A11 Ordinance 23-O-18: Decreasing Class D Liquor License for Yahala Inn For Introduction & Action To: Honorable Mayor and Members of the City Council Administration & Public Works Committee From: W. Grant Farrar, Corporation Counsel Theresa Whittington, Liquor Licensing Manager & Legal Analyst Subject: Ordinance 23-O-18, Decreasing the Number of Class D Liquor Licenses for 811 Church LLC dba Yahala Inn , 811 Church Street Date: February 1, 2018 Recommended Action: Staff recommends City Council adoption of Ordinance 23-O-18. Staff recommends suspension of the rules for Introduction and Action at the February 12, 2018 City Council meeting. Livability Benefit: Innovation & Process: Support local government best practices and processes. Summary: Ordinance 23-O-18 amends Evanston City Code of 2012 Subsection 3-4-6-(D), as amended, to decrease the number of authorized Class D liquor licenses from fifty-one (51) to fifty (50). 811 Church LLC Dba Yahala Inn, 811 Church Street is closed. This Ordinance amends the City Code to reflect the decrease in Class D liquor licenses. ------------------------------------------------------------------------------------- Attachments: Ordinance 23-O-18 Memorandum 265 of 549 02/01/18 23-O-18 AN ORDINANCE Amending City Code Section 3-4-6-(D) to Decrease the Number of Class D Liquor Licenses from Fifty-One to Fifty (811 Church LLC Dba Yahala Inn, 811 Church Street) NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Class D of Table 1, Section 3-4-6 of the Evanston City Code of 2012, as amended, is hereby further amended and revised as follows: D Restaurant Liquor None $2,800 $2,800 51 50 None 11 a.m.— 1 a.m. (Mon- Thurs); 11 a.m. – 2 a.m. (Fri-Sat); 12 p.m. – 1 a.m. (Sun) SECTION 2: Subsection 3-4-6-(D) of the Evanston City Code of 2012, as amended, is hereby further amended by decreasing the number of Class D liquor licenses from fifty-one (51) to fifty (50) to read as follows: (D) CLASS D licenses, which shall authorize the retail sale in restaurants only of alcoholic liquor for consumption on the premises where sold. No such license may be granted to or retained by an establishment in which the facilities for food preparation and service are not primarily those of a "restaurant", as defined in 3- 4-1 of this Chapter. Alcoholic liquor may be sold in restaurants holding Class D licenses only during the period when their patrons are offered a complete meal. The applicant for the renewal only of such licenses may elect to pay the amount required herein semiannually or annually. Such election shall be made at the time of application. The annual single-payment fee for initial issuance or renewal of such license shall be two thousand eight hundred dollars ($2,800.00). The total fee required hereunder for renewal applicants electing to make semiannual 266 of 549 23-O-18 ~2~ payments, payable pursuant to the provisions of Section 3-4-7 of this Chapter, shall be two thousand nine hundred forty dollars ($2,940.00). No more than to fifty-one (51) (50) such license(s) shall be in force at any one (1) time. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 5: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. SECTION 6: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 267 of 549 For City Council meeting of February 12, 2018 Item A12 Ordinance 24-O-18 – Increase Class D Liquor License – Good to Go For Introduction To: Honorable Mayor and Members of the City Council Administration & Public Works Committee From: W. Grant Farrar, Corporation Counsel Theresa Whittington, Liquor Licensing Manager/Legal Analyst Subject: Ordinance 24-O-18, Increasing the Number of Class D Liquor Licenses for Good to Go Jamaican Cuisine, LLC dba Good to Go, 711 Howard Street Date: February 1, 2018 Recommended Action: Local Liquor Commissioner recommends City Council adoption of Ordinance 24-O-18. Livability Benefits: Economy & Jobs: Retain and expand local businesses. Summary: Ordinance 24-0-18 amends Evanston City Code of 2012 Subsection 3-4-6-(D), as amended, to increase the number of Class D Liquor Licenses from fifty (50) to fifty-one (51) and permit issuance of a Class D license to Good to Go Jamaican Cuisine, LLC dba Good to Go, 711 Howard Street. This license will permit Company to retail sale of alcoholic liquor in restaurants only to persons of at least twenty-one (21) years of age for consumption on the premises. Company representative Lenice Levy submitted application materials. Legislative History: At the January 31, 2018 Liquor Control Review Board meeting, Company requested consideration of application for a Class D liquor license. ------------------------------------------------------------------------------------- Attachments: Ordinance 24-O-18 Application Minutes of the January 31, 2018 Liquor Control Review Board meeting Memorandum 268 of 549 02/01/18 24-O-18 AN ORDINANCE Amending City Code Section 3-4-6-(D) to Increase the Number of Class D Liquor Licenses from Fifty to Fifty-one (Good to Go Jamaican Cuisine, LLC Dba Good to Go 711 Howard Street) NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Class D of Table 1, Section 3-4-6 of the Evanston City Code of 2012, as amended, is hereby further amended and revised as follows: D Restaurant Liquor None $2,800 $2,800 50 51 None 11 a.m.— 1 a.m. (Mon- Thurs); 11 a.m. – 2 a.m. (Fri-Sat); 12 p.m. – 1 a.m. (Sun) SECTION 2: Subsection 3-4-6-(D) of the Evanston City Code of 2012, as amended, is hereby further amended by increasing the number of Class D liquor licenses from fifty (50) to fifty-one (51) to read as follows: (D) CLASS D licenses, which shall authorize the retail sale in restaurants only of alcoholic liquor for consumption on the premises where sold. No such license may be granted to or retained by an establishment in which the facilities for food preparation and service are not primarily those of a "restaurant", as defined in 3- 4-1 of this Chapter. Alcoholic liquor may be sold in restaurants holding Class D licenses only during the period when their patrons are offered a complete meal. The applicant for the renewal only of such licenses may elect to pay the amount required herein semiannually or annually. Such election shall be made at the time of application. The annual single-payment fee for initial issuance or renewal of such license shall be two thousand eight hundred dollars ($2,800.00). 269 of 549 24-O-18 ~2~ The total fee required hereunder for renewal applicants electing to make semiannual payments, payable pursuant to the provisions of Section 3-4-7 of this Chapter, shall be two thousand nine hundred forty dollars ($2,940.00). No more than fifty (50) fifty-one (51) such license(s) shall be in force at any one (1) time. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 5: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. SECTION 6: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 270 of 549 REDACTED 271 of 549 272 of 549 273 of 549 274 of 549 275 of 549 276 of 549 277 of 549 278 of 549 279 of 549 280 of 549 REDACTED 281 of 549 2/2/2018 360training.com - Welcome! https://www.learn2serve.com/webapp/wcs/stores/servlet/PrintReceiptView?storeId=21701&orderId=7265682&catalogId=10051&langId=-1&shipmentTypeId=1 1/3 PrintWe recommend you print this page. Dear Lenice Levy, Thank you for shopping at 360training.com. We received your order 7265682. We are processing the payment for your order. When we have successfully processed your payment, you will receive another email on successful registration. If you have any questions or concerns about your order, you can contact us by email at support@360training.com or by phone at 18778812235. If your order contains a shippable product, you will receive an email with the shipping and tracking information, once your order is shipped. Thanks again for shopping at 360training.com. Order Details Order Number: 7265682 Order date: February 2, 2018 Account Information To access your course(s): Illinois BASSET Alcohol SellerServer Use the following login information: Login:Click here to begin your courses Username:lenicelevy Forgot Password:Click here to reset your password282 of 549 2/2/2018 360training.com - Welcome! https://www.learn2serve.com/webapp/wcs/stores/servlet/PrintReceiptView?storeId=21701&orderId=7265682&catalogId=10051&langId=-1&shipmentTypeId=1 2/3 Email:info@goodtogorestaurant.com Phone:7736366300 Address:711 Howard Evanston Illinois United States 60202 Product Qty Each Total Illinois BASSET Alcohol SellerServer SKU: 65486161396577158137038370859ee9dc9329206 48b3a6e213119a11f688 1 $13.99 $13.99 Order Subtotal: $13.99 Total discounts on products:: ($1.40) Total discounts on order: $0.00 Tax: $0.00 Shipping: $0.00 Shipping Tax: $0.00 Order Total: $12.59 Billing Information Billing Address: Lenice Levy 711 Howard Evanston Illinois United States 60202 7736366300 info@goodtogorestaurant.com Billing Method: PayPal Amount:$12.59 Please retain this email for your records. 283 of 549 2/2/2018 360training.com - Welcome! https://www.learn2serve.com/webapp/wcs/stores/servlet/PrintReceiptView?storeId=21701&orderId=7265682&catalogId=10051&langId=-1&shipmentTypeId=1 3/3 Thank you! The 360training.com We provide individuals, businesses, and content partners with integrated eLearning SaaS solutions and earn their loyalty through exceptional customer satisfaction. Please see our Privacy Policy for more information www.360training.com | Copyright 360training.com, NY. 2018. 284 of 549 285 of 549 286 of 549 287 of 549 288 of 549 289 of 549 290 of 549 Final Page 1 of 4 C MEETING MINUTES Liquor Control Board Wednesday, January 31, 2018 11:00 a.m. Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Room 2750 Members Present: Mayor Stephen H. Hagerty (Local Liquor Control Commissioner); Marion Macbeth; Dick Peach Members Absent: None Staff Present: Grant Farrar, Theresa Whittington Others Present: Lenice Levy (Good to Go); Dennis Levy (Good to Go); Rob Spengler (Board & Brush); Drew Valko (Board & Brush); Shannon Valko (Board & Brush); Michael binsteil (Binny’s); Kevin Gazly (Binny’s); Greg Versch (Binny’s) Presiding Member: Local Liquor Control Commissioner Stephen H. Hagerty/Mayor CALL TO ORDER The Local Liquor Control Commissioner Stephen Hagerty called the meeting to order at 11:03 a.m. NEW BUSINESS Good to Go Jamaican Cuisine, LLC dba Good to Go, 711 Howard Street Lenice Levy (LL), owner, requested approval of a class D (restaurant/liquor) liquor license. LL explained that she and her husband (Dennis Levy) purchased the building at 711 Howard street and are in the process of renovating it. For 16 years they have owned and operated Good to Go on the Chicago side of Howard street. They are long time Evanston residents and are excited to move the restaurant across the street into the renovated building on the Evanston side of Howard. Good to Go will be a full service restaurant with a private event space that can accommodate 150 people. Mayor Hagerty inquired if Good to Go has had any alcohol violations related to underage drinking at its Chicago establishment. LL responded that there have been no issues. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended issuance of a liquor license to be introduced at the City Council meeting on February 12, 2018. Target Corporation, Dba Target Stores T3283, 1616 Sherman Ave Krysanna Bowery (KB), Team Leader, attended the meeting on behalf of Target and requested approval of a Class F (grocery/liquor) license. KB stated that Target wished to be a one stop shop with alcohol to cater to customer needs. She stated that most neighboring city Target stores sell alcohol. 1400 stores nationwide sell liquor. Target 291 of 549 Final Page 2 of 4 conducts extensive training of its Team Leaders on responsible sale of alcohol with a 90% and greater test score. The point of sale system in place at Target requires cashiers to obtain photo ID from all customers purchasing alcohol. Marion Macbeth reminded KB of the close proximity to NU. Mayor Hagerty asked if all cashiers are BASSET trained. KB explained that only Team Leaders are BASSET trained and cashiers undergo internal liquor training. Mayor Hagerty asked if she has had any issues with underage drinking at Target stores. KB responded that there have not been any issues in any of the stores she has worked at over the past 12 years. Mayor Hagerty reminded KB of the privilege and responsibility of having a liquor license and that there is a zero tolerance for underage drinking. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended issuance of a liquor license to be introduced at the City Council meeting on February 12, 2018. Board and Brush Creative Studio, 802 Dempster Drew Valko (DV), owner, requested approval of a new liquor license classification for an Arts and Craft studio that hosts activities involving "painting, ceramics, woodworking, craft design, and construction projects utilizing fibers, metals, wood or glass" to be able to serve beer and wine to customers for on-premises consumption. He explained that Board & Brush is a franchise that hosts wood board décor workshops 3-4 nights a week and weekends. Wood is distressed at the beginning of class using drill and hammers and similar tools. These are all put away within the first 10-15 minutes of class. Classes are instructor led. The remainder of class is spent sanding, painting and staining. There are about 200 locations and the average consumption is 1-2 drinks. They are seeking beer and wine only. Mayor Hagerty characterized the business as an “experiential” business. Shannon Valko stated that it’s a social gathering experience. Dick Peach said he was not thrilled about adding yet another liquor license classification but said it is a unique application and has no issue creating a license class for it. Marion Macbeth appreciated that the distressing tools are put away early in the process. Shannon Valko stated that there are over 200 location and almost all offer alcohol. Similar new liquor license classes have been adopted in Park Ridge, Downers Grove and New Lennox. The owners of Board & Brush also own Little Beans Café in Evanston. Mayor Hagerty said he was amenable to creating a new liquor license class. Grant Farrar clarified the process and stated that the new license class would be presented to City Council first. Once the new license class is created, the applicant can submit an applicaiotn for issuance of liquor license. Mayor Hagerty reminded the applicants of he zero tolerance for underage drinking. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended creation of a new liquor license classification to be introduced at the City Council meeting on February 26, 2018. Binny’s Beverage Depot, 111 Chicago Ave Mayor Hagerty shared his appreciation to Binny’s for listening to his concerns about the proposed amendments to license class K. Mayor Hagerty asked Binny’s representatives to introduce themselves and discuss the revised proposal to amend license class F-1. Michael Binstein (MB), owner, stated that Binny’s was started in 1948 292 of 549 Final Page 3 of 4 by his father. It is a private, family-owned business. It offers a range of products not currently offered in Evanston. Binny’s has been interested in opening in Evanston for 15years and feels it has finally found the right location at 111 1 Chicago Ave. Binny’s needs a big store to house its big selection. It has 30 employees on staff on a typical day. MB said the crux of the proposed F-1 changes revolve around craft beer container sizes and education and tasting seminars to customers. Smaller craft beer sizes are needed to be able to offer the best selection. He further suggests changing those sizes for all license class holders. Binny’s has nationally acclaimed educators that offer tasting seminars to customers. These sorts of seminars are currently offered at the Lincoln Park and Highland Park locations. He would like to offer similar events in the Evanston store. At the request of Mayor Hagerty, Grant Farrar (GF) summarized the differences between Classes K and F-1. GF explained that the main differences related to scale and fees. Binny’s proposal would require amendments to the existing class F -1. Craft beer container sizes have been evolving rapidly. Binny’s requested changes to container size could be extended to other license classes should they seek a similar amendment. Mayor Hagerty asked MB to discuss what sort of food products would Binny’s stock. MB said Binny’s would have a modest selection of “drink local and eat local” items. It will be a rotating selection of items from local artisans from food and liquor. It is a new and exciting category for Binny’s. The meeting was turned over to pubic comments. Eight (8) people spoke and asked questions. Some questions pertained to fees, zoning and square footage. Others included comments that class K is not appropriate; a Class E would be more appropriate; that Binny’s should not be granted any amendments; Binny’s should have to “play by the rules” and requests that Binny’s sell food items. Mayor Hagerty summarized the issues and challenges to the Class K, E and F licenses with respect to Binny’s. He noted that the issue raised about Class F businesses opening within 500 feet of each other illustrates the need to clean up conflicts that exist in the city’s liquor code since the City already has businesses that are not in compliance with that particular requirement. Mayor Hagerty asked staff and liquor board members if it has previously made modifications to liquor license classes in the past. Grant Farrar responded “many times” by applicants and prospective applicants and estimates about 50 amendments over the past eight years. He summarized the various amendments made to license class K in 2009, 2013, and 2015 at the request of current license holders. Marion Macbeth commented that many of the amendments were made at the request and benefit of small business owners and feels the double standard for a larger business is not appropriate. Dick Peach agrees and adds that at the time the Class E liquor store license was created it was restricted to downtown because liquor sales were still relatively new to Evanston. Evanston 1st Liquors was one of the very first licenses issued. The thought was that containing alcohol to downtown would allow the City to better control it. Since then, Evanston has changed a lot and it has added a lot of new liquor licenses such as boutique wine stores and distilleries and craft breweries. He feels the board must be careful not to reject new ideas just because they come from a “big box”. He feels the City should be accommodating and not shut the door on any business. Mayor Hagerty said he likes the revised focus on the Class F. He agrees with Alderman Wynne’s desire to see some uniqueness with regards to a deli, cheese, demonstration kitchen or other similar food offerings. Alderman Rainey offered that Binny’s is so different that it might benefit from a new license class. Mayor Hagerty agreed that another F category, such as an F-2 might be more appropriate. Grant Farrar offered that the comments received by email and LCRB meeting will reviewed 293 of 549 Final Page 4 of 4 and incorporated as an amendment to license class F (F-2) or a brand new license classification, depending on the direction given by the board. Presentation of an ordinance to City Council is tentatively set for February 28th to allow time for staff to review the issues and comments and to get further details from Bin ny’s regarding its specific business model. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended creation of a new liquor license classification to be tentatively introduced at the City Council meeting on February 26, 2018. ADJOURNMENT The meeting was adjourned by the Local Liquor Control Commissioner Stephen H. Hagerty, Mayor at 12:28 p.m. January 31, 2018. Respectfully Submitted, Theresa Whittington Liquor Licensing Manager, Legal Department 294 of 549 For City Council meeting of February 12, 2018 Item A13 Ordinance 26-O-18: Increasing Class F Liquor License Target Store T3283 For Introduction To: Honorable Mayor and Members of the City Council Administration & Public Works Committee From: W. Grant Farrar, Corporation Counsel Theresa Whittington, Administrative Adjudication & Liquor Licensing Manager Subject: Ordinance 26-O-18, Increasing the Number of Class F Liquor Licenses for Target Corporation Dba Target Store T3283, 1616 Sherman Ave Date: February 1, 2018 Recommended Action: Local Liquor Commissioner provides a recommendation to City Council regarding the adoption of Ordinance 26-O-18. Livability Benefits: Economy & Jobs: Retain and expand local businesses Summary: Ordinance 26-O-18 amends Evanston City Code of 2012 Subsection 3-4-6-(F), as amended, to increase the number of authorized Class F liquor licenses from nine (9) to ten (10), and permit issuance of a Class F license to Target Corporation Dba Target Store T3283, 1616 Sherman Ave. This license will permit Company to retail sale of alcoholic liquor in grocery stores in original packages to persons of at least twenty-one (21) years of age for consumption off the premises. Application materials were submitted by Company representative Carole Helmin. Legislative History: At the January 31, 2018 Liquor Control Review Board meeting, Company requested consideration of application for a Class F liquor license Alternatives: n/a ------------------------------------------------------------------------------------- Attachments: Ordinance 26-O-18 Application Minutes of the January 31, 2018 Liquor Control Review Board meeting Memorandum 295 of 549 02/01/18 26-O-18 AN ORDINANCE Amending City Code Section 3-4-6-(F) to Increase the Number of Class F Liquor Licenses from Nine to Ten (Target Corporation Dba Target Store T3283, 1616 Sherman Ave) NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Class F of Table 1, Section 3-4-6 of the Evanston City Code of 2012, as amended, is hereby further amended and revised as follows: F Grocery None Liquor $35,000 $11,500 9 10 Store over 12,000 sq. ft. (product display) 8 a.m.— Midnight SECTION 2: Subsection 3-4-6-(F) of the Evanston City Code of 2012, as amended, is hereby further amended by increasing the number of Class F liquor licenses from nine (9) to ten (10) to read as follows: (F) CLASS F licenses, which shall authorize the retail sale of alcoholic liquor in grocery stores, combination stores as defined in Section 3-4-1 of this Chapter, and wholesale clubs requiring membership in original packages to persons of at least twenty-one (21) years of age for consumption off the premises. Class F licenses shall also authorize the tasting of alcoholic liquor not exceeding the limits set forth herein. 1. It shall be unlawful for a Class F licensee to sell a single container of bee r unless the volume of the container is greater than forty (40) ounces or 1.18 liters. It shall be unlawful for a licensee to bundle, tape, package, or otherwise manipulate single containers of beer for sale as a set. Any such manipulation of packaging shall be a violation of this Subsection. Nothing in this Subsection shall be construed as prohibiting the sale of packages containing six single containers of beer, including such packages consisting of various single containers of beer chosen by the consumer. 2. It shall be unlawful for a Class F licensee to sell a single container of wine unless the container is greater than sixteen (16) fluid ounces or 0.473 296 of 549 26-O-18 ~2~ liters. 3. It shall be unlawful for a Class F licensee to sell a single container of alcoholic liquor, except beer and wine which are regulated by Subsections (F)1 and (F)2 of this Section, unless the container is greater than sixteen (16) fluid ounces or 0.473 liters. 4. The sale of alcoholic liquor at retail pursuant to the Class F license may begin after 8:00 a.m., Monday through Sunday. Alcoholic liquor shall not be sold after the hour of 12:00 midnight on any day. 5. No such license may be granted to an establishment that is located within five hundred (500) feet of a licensee holding a Class F liquor license. 6. A Class F licensee shall provide a minimum of twelve thousand (12,000) square feet of production, preparation, and display area in which products are prepared and are for sale. 7. Class F licenses shall permit the tasting of samples of the alcoholic liquor permitted to be sold under this classification, on the licensed premises during authorized hours of business. No charge, cost, fee, or other consideration of any kind shall be levied for any such tasting. Licensees shall not provide more than three (3) free tastings, each of which shall not exceed one (1) fluid ounce for wine, two (2) fluid ounces for beer and one- quarter (.25) fluid ounce for distilled alcohol, to any person in a day. Licensees must have at least one (1) BASSET-certified site manager on- premises whenever offering alcoholic liquor for tastings. Licensees must provide food service when offering alcoholic liquor for tastings. The applicant for a Class F license shall pay a first year license fee of thirty-five thousand dollars ($35,000.00). Thereafter, the annual fee for a Class F license shall be eleven thousand five hundred dollars ($11,500.00). No more than nine (9) ten (10) such license(s) shall be in force at any one (1) time. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. 297 of 549 26-O-18 ~3~ SECTION 5: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. SECTION 6: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. Introduced: _________________, 2018 Adopted: ___________________, 201 8 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 298 of 549 REDACTED 299 of 549 300 of 549 301 of 549 302 of 549 303 of 549 304 of 549 REDACTED 305 of 549 306 of 549 307 of 549 308 of 549 309 of 549 310 of 549 311 of 549 312 of 549 313 of 549 314 of 549 315 of 549 316 of 549 317 of 549 318 of 549 319 of 549 320 of 549 321 of 549 322 of 549 323 of 549 Final Page 1 of 4 C MEETING MINUTES Liquor Control Board Wednesday, January 31, 2018 11:00 a.m. Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Room 2750 Members Present: Mayor Stephen H. Hagerty (Local Liquor Control Commissioner); Marion Macbeth; Dick Peach Members Absent: None Staff Present: Grant Farrar, Theresa Whittington Others Present: Lenice Levy (Good to Go); Dennis Levy (Good to Go); Rob Spengler (Board & Brush); Drew Valko (Board & Brush); Shannon Valko (Board & Brush); Michael binsteil (Binny’s); Kevin Gazly (Binny’s); Greg Versch (Binny’s) Presiding Member: Local Liquor Control Commissioner Stephen H. Hagerty/Mayor CALL TO ORDER The Local Liquor Control Commissioner Stephen Hagerty called the meeting to order at 11:03 a.m. NEW BUSINESS Good to Go Jamaican Cuisine, LLC dba Good to Go, 711 Howard Street Lenice Levy (LL), owner, requested approval of a class D (restaurant/liquor) liquor license. LL explained that she and her husband (Dennis Levy) purchased the building at 711 Howard street and are in the process of renovating it. For 16 years they have owned and operated Good to Go on the Chicago side of Howard street. They are long time Evanston residents and are excited to move the restaurant across the street into the renovated building on the Evanston side of Howard. Good to Go will be a full service restaurant with a private event space that can accommodate 150 people. Mayor Hagerty inquired if Good to Go has had any alcohol violations related to underage drinking at its Chicago establishment. LL responded that there have been no issues. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended issuance of a liquor license to be introduced at the City Council meeting on February 12, 2018. Target Corporation, Dba Target Stores T3283, 1616 Sherman Ave Krysanna Bowery (KB), Team Leader, attended the meeting on behalf of Target and requested approval of a Class F (grocery/liquor) license. KB stated that Target wished to be a one stop shop with alcohol to cater to customer needs. She stated that most neighboring city Target stores sell alcohol. 1400 stores nationwide sell liquor. Target 324 of 549 Final Page 2 of 4 conducts extensive training of its Team Leaders on responsible sale of alcohol with a 90% and greater test score. The point of sale system in place at Target requires cashiers to obtain photo ID from all customers purchasing alcohol. Marion Macbeth reminded KB of the close proximity to NU. Mayor Hagerty asked if all cashiers are BASSET trained. KB explained that only Team Leaders are BASSET trained and cashiers undergo internal liquor training. Mayor Hagerty asked if she has had any issues with underage drinking at Target stores. KB responded that there have not been any issues in any of the stores she has worked at over the past 12 years. Mayor Hagerty reminded KB of the privilege and responsibility of having a liquor license and that there is a zero tolerance for underage drinking. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended issuance of a liquor license to be introduced at the City Council meeting on February 12, 2018. Board and Brush Creative Studio, 802 Dempster Drew Valko (DV), owner, requested approval of a new liquor license classification for an Arts and Craft studio that hosts activities involving "painting, ceramics, woodworking, craft design, and construction projects utilizing fibers, metals, wood or glass" to be able to serve beer and wine to customers for on-premises consumption. He explained that Board & Brush is a franchise that hosts wood board décor workshops 3-4 nights a week and weekends. Wood is distressed at the beginning of class using drill and hammers and similar tools. These are all put away within the first 10-15 minutes of class. Classes are instructor led. The remainder of class is spent sanding, painting and staining. There are about 200 locations and the average consumption is 1-2 drinks. They are seeking beer and wine only. Mayor Hagerty characterized the business as an “experiential” business. Shannon Valko stated that it’s a social gathering experience. Dick Peach said he was not thrilled about adding yet another liquor license classification but said it is a unique application and has no issue creating a license class for it. Marion Macbeth appreciated that the distressing tools are put away early in the process. Shannon Valko stated that there are over 200 location and almost all offer alcohol. Similar new liquor license classes have been adopted in Park Ridge, Downers Grove and New Lennox. The owners of Board & Brush also own Little Beans Café in Evanston. Mayor Hagerty said he was amenable to creating a new liquor license class. Grant Farrar clarified the process and stated that the new license class would be presented to City Council first. Once the new license class is created, the applicant can submit an applicaiotn for issuance of liquor license. Mayor Hagerty reminded the applicants of he zero tolerance for underage drinking. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended creation of a new liquor license classification to be introduced at the City Council meeting on February 26, 2018. Binny’s Beverage Depot, 111 Chicago Ave Mayor Hagerty shared his appreciation to Binny’s for listening to his concerns about the proposed amendments to license class K. Mayor Hagerty asked Binny’s representatives to introduce themselves and discuss the revised proposal to amend license class F-1. Michael Binstein (MB), owner, stated that Binny’s was started in 1948 325 of 549 Final Page 3 of 4 by his father. It is a private, family-owned business. It offers a range of products not currently offered in Evanston. Binny’s has been interested in opening in Evanston for 15years and feels it has finally found the right location at 111 1 Chicago Ave. Binny’s needs a big store to house its big selection. It has 30 employees on staff on a typical day. MB said the crux of the proposed F-1 changes revolve around craft beer container sizes and education and tasting seminars to customers. Smaller craft beer sizes are needed to be able to offer the best selection. He further suggests changing those sizes for all license class holders. Binny’s has nationally acclaimed educators that offer tasting seminars to customers. These sorts of seminars are currently offered at the Lincoln Park and Highland Park locations. He would like to offer similar events in the Evanston store. At the request of Mayor Hagerty, Grant Farrar (GF) summarized the differences between Classes K and F-1. GF explained that the main differences related to scale and fees. Binny’s proposal would require amendments to the existing class F -1. Craft beer container sizes have been evolving rapidly. Binny’s requested changes to container size could be extended to other license classes should they seek a similar amendment. Mayor Hagerty asked MB to discuss what sort of food products would Binny’s stock. MB said Binny’s would have a modest selection of “drink local and eat local” items. It will be a rotating selection of items from local artisans from food and liquor. It is a new and exciting category for Binny’s. The meeting was turned over to pubic comments. Eight (8) people spoke and asked questions. Some questions pertained to fees, zoning and square footage. Others included comments that class K is not appropriate; a Class E would be more appropriate; that Binny’s should not be granted any amendments; Binny’s should have to “play by the rules” and requests that Binny’s sell food items. Mayor Hagerty summarized the issues and challenges to the Class K, E and F licenses with respect to Binny’s. He noted that the issue raised about Class F businesses opening within 500 feet of each other illustrates the need to clean up conflicts that exist in the city’s liquor code since the City already has businesses that are not in compliance with that particular requirement. Mayor Hagerty asked staff and liquor board members if it has previously made modifications to liquor license classes in the past. Grant Farrar responded “many times” by applicants and prospective applicants and estimates about 50 amendments over the past eight years. He summarized the various amendments made to license class K in 2009, 2013, and 2015 at the request of current license holders. Marion Macbeth commented that many of the amendments were made at the request and benefit of small business owners and feels the double standard for a larger business is not appropriate. Dick Peach agrees and adds that at the time the Class E liquor store license was created it was restricted to downtown because liquor sales were still relatively new to Evanston. Evanston 1st Liquors was one of the very first licenses issued. The thought was that containing alcohol to downtown would allow the City to better control it. Since then, Evanston has changed a lot and it has added a lot of new liquor licenses such as boutique wine stores and distilleries and craft breweries. He feels the board must be careful not to reject new ideas just because they come from a “big box”. He feels the City should be accommodating and not shut the door on any business. Mayor Hagerty said he likes the revised focus on the Class F. He agrees with Alderman Wynne’s desire to see some uniqueness with regards to a deli, cheese, demonstration kitchen or other similar food offerings. Alderman Rainey offered that Binny’s is so different that it might benefit from a new license class. Mayor Hagerty agreed that another F category, such as an F-2 might be more appropriate. Grant Farrar offered that the comments received by email and LCRB meeting will reviewed 326 of 549 Final Page 4 of 4 and incorporated as an amendment to license class F (F-2) or a brand new license classification, depending on the direction given by the board. Presentation of an ordinance to City Council is tentatively set for February 28th to allow time for staff to review the issues and comments and to get further details from Bin ny’s regarding its specific business model. The Local Liquor Control Commissioner asked the members if there were any further questions or concerns over the request. None were voiced. The Board recommended creation of a new liquor license classification to be tentatively introduced at the City Council meeting on February 26, 2018. ADJOURNMENT The meeting was adjourned by the Local Liquor Control Commissioner Stephen H. Hagerty, Mayor at 12:28 p.m. January 31, 2018. Respectfully Submitted, Theresa Whittington Liquor Licensing Manager, Legal Department 327 of 549 For City Council of February 12, 2018 Item A14 Ordinance 28-O-18, Ridge Avenue Speed Limit Reduction For Introduction and Action To: Honorable Mayor and Members of the City Council Administration and Public Works Committee From: David D. Stoneback, Public Works Agency Director Lara Biggs, P.E., Bureau Chief – Capital Planning / City Engineer Rajeev Dahal, Senior Project Manager - Transportation Subject: Ridge Avenue Corridor – Church Street to Howard Street Recommendations Date: January 31, 2018 Recommended Action: Staff recommends that City Council adopt Ordinance 28-O-18 to reduce the speed limit on Ridge Avenue between Emerson Street and Howard Street to 25 mph. Staff also recommends the City Council authorize the City Manager to: 1) direct the Evanston Police Department to provide targeted enforcement of traffic regulations within the Ridge Avenue Corridor, and 2) implement split phasing of the traffic signals at the Ridge/Lake intersection on a trial basis. Staff further recommends suspension of rules for Introduction and Action of the Ordinance. Funding Source: Funding for the estimated $10,000 to implement the split phasing of the traffic signals at the Ridge / Lake Intersection will be from Account 100.40.4520.65115, which has an FY 2108 budget allocation of $58,000. Livability Benefits: Built Environment: Promote diverse transportation modes Health & Safety - Improve health outcomes Background: Staff made a detailed presentation at the Administration & Public Works Committee on January 22, 2017, regarding the Ridge Avenue corridor issues. During the discussion at that meeting, staff was directed to come back with specific recommendations to the City Council. Memorandum 328 of 549 Analysis: Staff recommends that the following three suggestions be implemented along the Ridge Avenue Corridor in the near future: 1. Reduce speed limit to 25 mph There is a safety benefit to reduced vehicle speeds. In addition to reducing the risk of injury when an accident occurs, lower speeds allow better reaction time to drivers and reduced stopping distance to avoid accidents. The Ridge Avenue corridor traffic signals have previously been coordinated to allow for better traffic flow at 26 mph. With approval, staff will prepare an ordinance to lower the speed limit from 30 mph to 25 mph on Ridge Avenue from Emerson Street to Howard Street. The signal timing will not be adjusted at this time. 2. Enforcement of speeds and traffic regulations EPD will continue their efforts with targeted enforcement to encourage behavior changes. These efforts will focus on speeding, disobeying traffic regulations, and distracted driving, and seat belt requirements. These weekly efforts will continue through the end of March 2018, and an assessment will be made regarding the outcomes. 3. Split phase Ridge/Lake intersection signals A primary cause of accidents at the Ridge/Lake Intersection is northbound Ridge Avenue traffic turning left onto westbound Lake Street. The accidents at this location may have increased due to left turn restrictions from Ridge onto Grove, which was implemented to mitigate accidents at that location. To address the left turning accidents, split phasing of the Ridge/Lake traffic signal could be implemented on a trial basis. Similar to the intersections at Ridge/Main and Ridge/Oakton, traffic signals would be timed to allow all northbound traffic, then all southbound traffic, and then all east-/westbound traffic. This type of signal phasing has been effective in addressing the type of left turn accidents that have been occurring at Ridge/Lake. However, the interruption to the flow of traffic caused by split phasing may result in significant traffic back-ups occurring during the morning and afternoon peak hours. In addition, some traffic may move to other parallel streets, such as Asbury Avenue. Initial review of the intersection indicates that this can be done by in-house staff electricians working with a traffic signal vendor for an estimated cost of $10,000. This work could be implemented in the spring of 2018. The trial is proposed to continue through December 2018, which would capture traffic differences that occur in summer versus fall (when school is back in session) as well as extending the trial period until after the traffic detour from the Sheridan Road construction is over. 329 of 549 It should be noted that the Forestry Division completed the trimming of trees along Ridge Avenue to improve signal visibility in early February. Forestry will check the corridor again in May, after the trees leaf out, to determine if further trimming is needed to maintain good lines of sight in both directions. Staff will request funding in the FY 2019 Capital Improvement Program to conduct a comprehensive study of the Ridge corridor to include assessment of adding left turn arrows on major side streets and northbound onto Davis, additional “walk” time for pedestrians; removing push button pedestrian operation, and retiming of the corridor. This study could also consider mast arm signals and/or other lane modifications. Attachments: Ordinance 28-O-18 330 of 549 2/6/2018 28-O-18 AN ORDINANCE Amending Schedule I, “Speed Limit Increased,” of City Code Section 10-11-1 Reducing the Speed Limit on Ridge Avenue between Howard Street and Emerson Street from 30 MPH to 25 MPH NOW BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: Section 10-11-1, Schedule I of the Evanston City Code of 2012, as amended, “Speed Limit Increased,” is hereby further amended as follows: Ridge Avenue – City limits south to City limits north Isabella Street to Emerson Street 30 mph SECTION 2: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and will be received in evidence as provided by the Illinois Complied Statues and the courts of the State of Illinois. SECTION 3: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 4: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 5: This ordinance will be in full force and effect from and after its passage, approval and publication in the manner provided by law. 331 of 549 28-O-18 ~2~ Introduced:_________________, 2018 Adopted:___________________, 2018 Approved: _________________________, 2018 ______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 332 of 549 For Administration and Public Works meeting of Feb 12, 2018 Item APW1 Sidewalk Inquiries For Discussion To: Administration and Public Works Committee From: Sue Pontarelli, 311 Manager Ashley King, Finance & Budget Manager Dave Stoneback, Public Works Agency Director Subject: 2017 Sidewalk Service Inquiries Date: February 12, 2018 Recommended Action: Staff recommends that City Council review the updated analysis of the sidewalk inquiries received by the City’s 311 department in 2017 and request direction. Analysis: During 2017, there were 404 sidewalk service requests at the following locations: Memorandum 333 of 549 There are two types of sidewalk requests received by 311—sidewalk evaluation and sidewalk maintenance. To put the 404 requests in context: • In 2017, there were 33,405 total 311 requests. Sidewalks represent 1.21% of the total number of requests. • There were 317 pot hole requests in 2017. • In 2017, there were 11,922 Public Works Agency requests. Sidewalks represent 3.4% of the total of PWA requests. Sidewalk Evaluation Sidewalk evaluation requests are for buckling sidewalks that could be caused by tree roots and/or to request participation in the 50/50 sidewalk and curb replacement program. These requests are for your own sidewalk/property. A supervisor from streets and sanitation will inspect the property within 5 business days. In 2017, there were 246 Sidewalk Evaluation requests throughout Evanston in the following locations: A complete listing of these requests is included as Attachment 1: Sidewalk Evaluations. Sidewalk Maintenance Sidewalk Maintenance requests are reports about the condition of cement or brick sidewalks that are not in front of your property. For Sidewalk Maintenance requests, the goal is for someone to review the sidewalk within one business day. In 2017, there were 158 Sidewalk Maintenance requests throughout Evanston in the following locations: 334 of 549 A complete listing of these requests is included as Attachment 2: Sidewalk Maintenance. Of the 404 sidewalk inquiries received: Attachments: Attachment 1: Sidewalk Evaluations Attachment 2: Sidewalk Maintenance 50/50 Program 279 69.06% Issue Resolved 89 22.03% Miscategorized 15 3.71% On repair list 10 2.48% Private Property 7 1.73% Request Denied 3 0.74% Other 1 0.25% TOTAL REQUESTS 404 100.00% Sidewalk Requests 335 of 549 Id Description Address Comments Type 2249051 The sidewalk has sunk and water and ice collect on the sidewalk. Caller reports this is along the entire block. Resident is asking for the city to evaluate the sidewalk for replacement. 1240 Wesley Avenue, Evanston, IL, United States John Jaminski on 2017-01-13 14:54:39 -0600 commented: 50/50? 50/50 Program 2254930 Sidewalk in front of our house has always been sunken. Now it is actually collapsing. We rod our sewer line every year and just had it rodded on 1/13. Sidewalk is collapsing by city water line, not by our sewer line. 2716 Hartzell St, Evanston, IL 60201, USA John Jaminski on 2017-01-17 15:10:53 -0600 commented: water line is not collapsing sidewalk just a little low Michelle Males (311) on 2017-01-27 10:35:15 -0600 commented: Caller requested status update: SDO advised completion date as well as above comment. Deborah Burns on 2017-01-29 20:32:36 -0600 commented: Response is not sufficient. What is status of water line? Jennifer Levi on 2017-01-29 20:13:42 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. Jennifer Levi on 2017-01-30 07:43:39 -0600 commented: Good morning, I have been advised that the water line is in good condition but, the sidewalk may be in need of repair due to it being a little lower than normal. Deborah Burns on 2017-03-13 14:34:21 -0500 commented: I never received 50/50 sidewalk brochure and do not see attachment here. Please sent 50/50 brochure via US mail. 50/50 Program 2257122 Caller is reporting that the sidewalk in front of this address dips which causes standing water and icy/ slippery conditions when the water freezes. Caller is interested in having the sidewalk in front of this address replaced. 543 Michigan Avenue, Evanston, IL, United States Jennifer Levi on 2017-01-29 21:39:27 -0600 commented: A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2257133 Sidewalk along Ridge on the South East corner. The sidewalk floods in this area after a rain and does not drain. This is particular serious when the water freezes. Monticello Pl. and Ridge, Evanston, IL Traci Kurtzer on 2017-01-17 22:33:15 -0600 commented: It has been getting worse every year since the road was upgraded for sewer drainage. I complained about it last year as the ice was an inch thick and salt would not melt through. It rained last night, flooded across this morning and still like that when I returned home from work tonight at 9pm. Traci Kurtzer on 2017-01-17 22:34:56 -0600 commented: Picture from this am Traci Kurtzer on 2017-01-22 16:57:35 -0600 commented: Any update on this request? The flooding finally dried up yesterday. This picture attached was taken 3 days after rainstorm, so something definitely not draining well along Ridge there. John Jaminski on 2017-01-23 06:41:03 -0600 commented: The ground still has 12" of frost in the ground so the water has no where to drain. Will pass this to 50/50 program. Thank you for using 311. Jennifer Levi on 2017-01-23 13:24:45 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the location provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2257436 Caller states the majority of his sidewalk is completely submerged; this is a re-occuring problem. 1321 Elmwood Avenue, Evanston, IL, United States Jennifer Levi on 2017-01-29 21:44:11 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2258606 Caller states there is an issue with his sidewalk as standing water is coming from snow and rain and it has not dispersed properly. 2127 Greenwood Street, Evanston, IL, United States Jennifer Levi on 2017-01-23 13:15:12 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2261101 Caller is from St. Matthews Episcopal Church Office. Caller advised that multiple sidewalk squares in front of this address are sunken in (on both the Lincoln & Hartrey sides) which has recently caused standing water on the sidewalk and as a result of cold temperatures the water froze (causing slippery conditions). Caller is requesting that this sidewalk be evaluated to determine whether the squares can be repaired/ replaced. 2120 Lincoln Street, Evanston, IL, United States Jennifer Levi on 2017-01-29 20:52:02 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2262836 Caller is reporting that the sidewalk is low adjacent to this property and causes standing water that freezes in the Winter. Caller is requesting a follow up in regards to repairing/ replacing this sidewalk. 225 Greenwood Street, Evanston, IL, United States Jennifer Levi on 2017-01-29 21:07:58 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the representative . This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2268447 neighbor called to report standing water on sidewalk after every heavy rainfall. 622 South Blvd, Evanston, IL, United States Jennifer Levi on 2017-01-29 20:00:29 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2269515 we were accepted on this plan in 2015 - but i forgot to send in the $ in time. thanks 3040 Hartzell St, Evanston, IL 60201, USA Jennifer Levi on 2017-01-23 11:13:26 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program Attachment 1 336 of 549 Id Description Address Comments Type 2306168 Caller is reporting that the sidewalk squares in front of this address are buckling due to the parkway tree roots pushing up on the squares and making them uneven/ causing a dip in the walkway. Caller is requesting that the sidewalk to evaluated so that it can be repaired/ replaced in the 50/50 Sidewalk Program. 1912 Seward St, Evanston, IL 60202, USA John Jaminski on 2017-01-31 14:59:40 -0600 commented: Sidewalk re mediated. Jennifer Levi on 2017-02-01 10:37:10 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2318357 Caller states the side walk needs repair and is wondering about the details of the 50/50 program for her association. 2712 Prairie Ave, Evanston, IL 60201, USA John Jaminski on 2017-02-07 15:10:04 -0600 commented: remediated. Jennifer Levi on 2017-02-08 13:44:35 -0600 commented: Thank you for using 311! The 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. If you have any other questions please let us know. - Thank you 50/50 Program 2327169 Caller advised that he is the Manager of the Reba Place Fellowship and has multiple properties that he manages that he would like to participate in the 50/50 Sidewalk Replacement Program including 802 Monroe, 703 Seward, 726 Seward, & 715 Monroe. Caller is requesting a follow- up to discuss. 802 Monroe St, Evanston, IL 60202, USA Jennifer Levi on 2017-02-08 13:59:08 -0600 commented: Thank you for contacting 311! 50/50 Sidewalk Replacement Brochures will be sent to the addresses provided as soon as an evaluation has been done . Addresses will then be added to the 50/50 Sidewalk Replacement Project. Beverly Otey (311) on 2017-02-14 09:31:25 -0600 commented: Mr. Belser called requesting to talk to someone about the sidewalk evaluation. SDO transferred the call to Jennifer Levi. 50/50 Program 2328349 Resident is requesting an evaluation on the dipped sidewalk in front of his property. He would also like to speak to whoever comes out to look at the sidewalk. 2142 Brummel St, Evanston, IL 60202, USA Jennifer Levi on 2017-02-16 11:13:10 -0600 commented: Thank you for contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2335857 This a request for participation in the 5050 program 1516 Cleveland St, Evanston, IL 60202, USA John Jaminski on 2017-02-10 15:00:03 -0600 commented: re-mediated Jennifer Levi on 2017-02-15 13:58:16 -0600 commented: Thank you for contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2344518 Please submit sidewalk repair to 50/50 replace program. Need replacement ASAP. Dangerous walking conditions. 2716 Hartzell St, Evanston, IL 60201, USA Daniel Kwiecinski on 2017-02-14 14:59:11 -0600 commented: remediated Jennifer Levi on 2017-02-15 13:41:55 -0600 commented: Thank you for Contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. Beverly Otey (311) on 2017-03-09 15:23:56 -0600 commented: Resident reported she did not receive the Sidewalk Replacement Brochure. She is asking for the brochure to be sent to her by US Mail. Jennifer Levi on 2017-03-13 12:25:56 -0500 commented: Thank you for your patience, at this time locations submitted are currently under review and you will be contacted in a few weeks regarding the 50/50 Sidewalk Replacement Program. This information will include a list of steps to prepare for repair. Once that is complete you will then receive information regarding an estimate. In the meantime I have previously enclosed and brief informational brochure that will provide some useful details. Thank you for contacting 311! 50/50 Program 2391861 Caller is interested in the 50/50 program and reports between 4-6 squares, some on both ends of the property. Caller also reports having made this request before and that an evaluation was completed. See Request #1219789. 2316 Brown Ave, Evanston, IL 60201, USA Jennifer Levi on 2017-03-06 10:57:46 -0600 commented: Thank you for contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2394354 Caller is requesting sidewalk replacement at 2708-2714 Prairie Ave. 2708 Prairie Ave, Evanston, IL 60201, USA John Jaminski on 2017-03-02 14:49:08 -0600 commented: remeadiated. Jennifer Levi on 2017-03-06 14:00:17 -0600 commented: A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2395677 Resident has sidewalk slabs in front of the house that need repair. Resident would like an evaluation and more information regarding participation in the 50/50 sidewalk program. 2233 Grey Ave, Evanston, IL 60201, USA Jennifer Levi on 2017-03-07 10:15:51 -0600 commented: Thank you for contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2415956 Caller is interested in participating in the 2017 50/50 Sidewalk Replacement Program. Caller is requesting information on the program. 2203 Bennett Ave, Evanston, IL 60201, USA John Jaminski on 2017-03-10 15:01:38 -0600 commented: mitigated Jennifer Levi on 2017-03-13 11:29:50 -0500 commented: Thank you for your patience, at this time locations submitted are currently under review and you will be contacted in a few weeks regarding the 50/50 Sidewalk Replacement Program. This information will include a list of steps to prepare for repair. Once that is complete you will then receive information regarding an estimate. In the meantime I have enclosed and brief informational brochure that will provide some useful details. Thank you for contacting 311! 50/50 Program 337 of 549 Id Description Address Comments Type 2417875 I have asked to enroll in 50/50 program but have not received any estimates or communication 1516 Cleveland St, Evanston, IL 60202, USA Jennifer Levi on 2017-03-13 11:24:41 -0500 commented: Thank you for your patience, at this time locations submitted are currently under review and you will be contacted in a few weeks regarding the 50/50 Sidewalk Replacement Program. This information will include a list of steps to prepare for repair. Once that is complete you will then receive information regarding an estimate. In the meantime I have enclosed and brief informational brochure that will provide some useful details. Thank you for contacting 311! 50/50 Program 2424503 There is a 3" depression in one slab. Caller states that this is a trip hazard, especially in the dark. SDO notified front desk. 2611 Park Place, Evanston, IL, United States John Jaminski on 2017-03-17 06:37:34 -0500 commented: sidewalk mitigated. Thank you for using 311. Issue Resolved 2464991 Sidewalk by the curb is sinking. Caller reports this is a remnant from the Kendall Collage days. The house at 2370, just south of this property has a new sidewalk. 2380 Orrington Avenue, Evanston, IL, United States Nancy Wasielewski on 2017-05-16 07:14:18 -0500 commented: Hello Jennifer and / or Hank -- our carriageway sidewalk in front of 2380 Orrington was evaluated but we never received the followup for the cost estimate. Can you please let us know the cost for this sidewalk? Also when is this work estimated to be started and completed. Thank you. My phone number is 847-331-4207 and email is njwas@comcast.net Edgar Cano on 2017-03-27 15:20:31 -0500 commented: Thank you for your comments. We will forward this information to our 50/50 sidewalk program Manager. Thank you for using 311. Nancy Wasielewski on 2017-03-28 14:59:34 -0500 commented: Hello, using the 50/50 program what would it cost for replacement. I don't want people using this sidewalk to trip on the curb bump. We are planning a brick walk from public sidewalk to the street and I want the curbside sidewalk level before we proceed with plans for brick sidewalk. Thank you! Nancy Wasielewski Henry Daniels on 2017-03-29 08:55:45 -0500 commented: LM 3/29/17 for Nancy 8:55 am Henry Daniels on 2017-03-29 09:14:30 -0500 commented: SW Nancy 3/29/17 9:11 am. She is going to brick pave her service walk and is interested in using the 50/50 Program to replace her carriage walk. Yvette Hopson(311) on 2017-04-03 12:26:40 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Jennifer Levi on 2017-04-06 10:28:18 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 50/50 Program 2474251 Sidewalk is low and collects water.2323 Cowper Avenue, Evanston, IL, United States Edgar Cano on 2017-03-29 15:29:46 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Henry Daniels on 2017-04-12 15:02:45 -0500 commented: This location was evaluated today, Judi will receive invoicing and information regarding the 50/50 program. 50/50 Program 2475976 Caller advised that she manages the properties on the corner of Hinman & Hamilton (1141-1143 Hinman) and (418-426 Hamilton) Caller advised that recently the sidewalks on this corner were pulled up for Sewer work. Caller is inquiring as to what can be done or what she needs to do to replace the sidewalks. 1141-1143 Hinman Evanston IL Pelayo Enerio on 2017-03-30 08:16:04 -0500 commented: Working with Ms. Megan McConnel for a resolution. Beverly Otey (311) on 2017-04-13 11:15:11 -0500 commented: Called to ask if this location was on the 50/50 program. SDO transferred the call to Juhn in Public Works. 50/50 Program 2478483 Caller is interested in participating in the 50/50 Sidewalk Replacement Program specifically because the sidewalk adjacent to 2245 Central Park needs to be raised to prevent standing water puddles/ pooling. Caller is inquiring about this program and requesting information. 2245 Central Park Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-06 10:25:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2482584 Caller does not live at this address but is reporting that the sidewalks in front of 2421 Prospect Ave. are uneven and have poor drainage which causes standing water when it rains and hazardous slippery conditions when standing water freezes during Winter. Caller is requesting that the sidewalk be evaluated and the homeowner be notified. 2421 Prospect Avenue, Evanston, IL, United States Edgar Cano on 2017-03-31 08:07:06 -0500 commented: Multiple service requests have been submitted for this issue and they have all been merged into the following ticket number #2207797 to avoid duplication and improve service delivery. You will continue to be notified of the status of this work through the new ticket number #2207797. 50/50 Program 2484655 Caller would like to be added to the sidewalk replacement program. 2409 Lincolnwood Drive, Evanston, IL, United States Jennifer Levi on 2017-04-06 10:24:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 338 of 549 Id Description Address Comments Type 2487194 Resident has a corner property and is requesting participation in the 50/50 sidewalk replacement program. The slabs meet the path going up to the backyard, abutting the alley. 200 Grey Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-06 10:16:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2487491 Property owner requesting evaluation of the damaged slabs and further information on repairing them (i.e. 50/50 Sidewalk) 2018 Brummel Street, Evanston, IL, United States Edgar Cano on 2017-03-31 14:08:27 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-05 14:11:30 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2489796 Resident is requesting a sidewalk evaluation.1044 Lake Shore Boulevard, Evanston, IL, United States Edgar Cano on 2017-04-03 15:04:18 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-05 13:20:57 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2492556 undefined 1301 Lincoln St, Evanston, IL 60201, USA Edgar Cano on 2017-04-04 15:03:48 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-11 12:40:22 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2492670 Caller is requesting that her sidewalk be evaluated to determine whether a couple squares are in need of replacement. Caller advised that there are two squares that are uneven and crumbled/ missing pieces. Caller is requesting information on how to replace these squares. 1724 Asbury Avenue, Evanston, IL, United States Edgar Cano on 2017-04-04 15:08:51 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-11 12:35:53 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the current owner on April 5th 2017 by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2493433 Caller is reporting that there are some sidewalk squares in need of repair adjacent to 2740 Harrison St. 2740 Harrison St. is a corner lot on the South East corner of Harrison & Ewing and Caller advised the damaged squares are on the Ewing side. Caller is requesting that the sidewalk be evaluated and that information about replacing the sidewalk be sent to him. 2740 Harrison St, Evanston, IL, United States Edgar Cano on 2017-04-06 15:02:38 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-10 14:01:08 -0500 commented: hi, Can you please send me the exact location? Im assuming that the caller is not the property owner? I will then follow up with a 50/50 letter. Jennifer Levi on 2017-04-11 11:09:47 -0500 commented: A 50/50 Sidewalk Participation Letter will be sent to the address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2497795 Property manager for the property is requesting information on the 50/50 sidewalk program. Caller would like the information sent via email or US mail to: Tawani Property Management- Chicago, 7361 N. Greenview, Chicago, IL 60626 2437 Sheridan Road, Evanston, IL, United States Jennifer Levi on 2017-04-10 12:56:34 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question April 5, 2017. Todd Jackson received the 50/50 Participation Letter and fill out the WuFoo form. Mailing address has been updated. Thank you for using 311! 50/50 Program 2499397 You have already looked at the service. This is a request for replacement under the 50/50 program. 829 Hamlin St, Evanston, IL 60201, USA Lisa Pildes on 2017-04-04 21:57:57 -0500 commented: Please confirm that the City pays 100% of the cost, when the sidewalk is upended by tree roots, as is the case at 829 Hamlin. Henry Daniels on 2017-04-05 07:29:20 -0500 commented: This determination is made upon inspection within the process of 50/50 Sidewalk Replacement Program participation. Program information will be sent out for 50/50 Program to 829 Hamlin St and 2327 Park Place per our conversation 4/5/17 7:15am Lisa Pildes on 2017-04-05 10:54:34 -0500 commented: Thanks. If you are snail mailing the information, please send info for both addresses to 2327 Park Place, my home. Thanks for the quick response on this . Jennifer Levi on 2017-04-11 11:34:59 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail on April 05, 2017. I have sent an additional letter to 2327 Park Place, the owners email, and is attached to this request. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 339 of 549 Id Description Address Comments Type 2502769 Caller is interested in the 50/50 sidewalk program. 1728 West Leland Avenue, Chicago, IL, United States Michelle Males (311) on 2017-04-10 09:33:56 -0500 commented: Caller requested status update; SDO advised completion date. Jennifer Levi on 2017-04-10 12:38:38 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! Jennifer Levi on 2017-04-10 12:29:08 -0500 commented: Address Has been updated to: Ancel and Carmen Maourie 1728 Leland Avenue Evanston, Illinois 60201 50/50 Program 2508221 Caller is reporting that the sidewalk adjacent to this address is severely uneven and buckling which has caused multiple trips/ falls in the last year. Caller is inquiring as to what can be done to repair the sidewalk and is requesting that the sidewalk be evaluated. 1840 Asbury Avenue, Evanston, IL, United States Edgar Cano on 2017-04-07 15:14:47 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-13 13:12:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2508269 Resident is interested in participating in the 50/50 sidewalk replacement program. Resident would like to know how soon work would be available to start. 1916 Noyes Street, Evanston, IL, United States Jennifer Levi on 2017-04-11 11:14:08 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the email address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2508271 Resident is interested in participating in the 50/50 sidewalk replacement program. Resident would like to know how soon work would be available to start. 1920 Noyes Street, Evanston, IL, United States Jennifer Levi on 2017-04-10 11:14:17 -0500 commented: A 50/50 Sidewalk Participation Letter has been attached and a was also to the email address provided in regards to the property or properties in question. Please check your email for further instructions on how to participate in the 50/50 Sidewalk program. As for your question, construction will began in June of 2017. Thank you for using 311! 50/50 Program 2525222 Caller is interested in the 50/50 program.2404 Lee St, Evanston, IL, United States Edgar Cano on 2017-04-12 14:36:26 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-13 12:05:47 -0500 commented: A 50/50 Sidewalk Replacement Participation Letter was sent to the email and address provided in regards to the property or properties in question. Please check your email for instructions on how to participate in the 50/50 Sidewalk program. Thank you for using 311! 50/50 Program 2529124 Caller is interested in information on the 50/50 program. 2614 Hartzell Street, Evanston, IL, United States Edgar Cano on 2017-04-13 11:02:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-14 12:47:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2530203 Resident inquiring whether it is possible for her to pay for the repair of sidewalk slabs of someone else' property anonymously. 2007 Noyes Street, Evanston, IL, United States Jennifer Levi on 2017-04-18 15:35:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided via postal mail and email. The letter will explain the next steps that need to be taken. Thank you for using 311! Henry Daniels on 2017-04-17 07:26:32 -0500 commented: Patricia, Unfortunately that's not tow the program works but what you can do is communicate your request to your neighbor and work out an agreement between the two of you. Give us your neighbors address and we will send 50/50 Program information. 50/50 Program 2530253 Would like to replace all of the uneven sidewalk squares in front of my house 2743 Mcdaniel Ave, Evanston, IL 60201, USA Edgar Cano on 2017-04-13 15:01:03 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-14 12:42:01 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2530441 Resident would like the sidewalk slabs evaluated that are on the Asbury Avenue side of the property. Resident advises that the sidewalk slopes which then creates an icy hazard after precipitation during cold weather. 1300 Rosalie Street, Evanston, IL, United States Jennifer Levi on 2017-04-18 15:31:26 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided via postal mail and email. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-14 11:40:36 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 340 of 549 Id Description Address Comments Type 2530711 The Michigan Group Condo Association wishes to participate in the 50/50 sidewalk replacement program. If possible, we'd also like to have the concrete between the sidewalk and the street replaced at the same time (we would pay the full cost of this additional work). 923 Michigan Ave, Evanston, IL 60202, USA Jennifer Levi on 2017-06-12 13:19:46 -0500 commented: Good afternoon Susan, your location is still on the 50/50 Sidewalk Replacement list. we have also received your payment and it is currently being process. If there is any change I will let you know. -Jennifer Levi Thank you for using 311! Akilah Hagler (311) on 2017-06-12 10:20:34 -0500 commented: Caller reports sending a check for sidewalk replacement but the check has not cleared. Caller wants to know if this address is on the list for June. Jennifer Levi on 2017-04-18 15:13:43 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided via postal mail and Email. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2531047 Caller would like to participate on the 50/50 program. 1550 Asbury Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-18 12:47:59 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided via postal mail and email. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-14 08:30:54 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2531488 Due to settling, sidewalk has cracked resulting in potential trip hazards. 2719 Park Pl, Evanston, IL 60201, USA Jennifer Levi on 2017-04-18 12:04:53 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-14 11:39:29 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2531599 There is a small walkway off of the curb that has sunken and needs to be replaced. 2308 Foster St, Evanston, IL 60201, USA Edgar Cano on 2017-04-14 13:46:43 -0500 commented: Thank you for your comments. The carriage walk has been added to our list for mitigation inspection. The adjacent property owner can participate in the 50/50 Sidewalk program if interested. Thank you for using 311. 50/50 Program 2531606 The main concrete pad directly next to the walk leading up to the building has sunken which has caused a 2 inch differential which could potentially be a tripping hazard. 1825 Emerson St, Evanston, IL 60201, USA Edgar Cano on 2017-04-14 11:46:56 -0500 commented: Thank you for your comments. The pad is located on private property and not within the city right or way. Thank you for using 311. 50/50 Program 2531611 There is a small section of concrete walkway missing near the curb. 241 Callan Ave, Evanston, IL 60202, USA Edgar Cano on 2017-04-14 10:05:35 -0500 commented: Thank you for your comments. The carriage walk has been added to the list for mitigation inspection. The adjacent property owner may have to replace the walkway or call the city to get information on the 50/50 sidewalk program. Thank you for using 311. 50/50 Program 2531614 There is a sidewalk leading up to the doorway that needs to be replaced. 140 Callan Ave, Evanston, IL 60202, USA Edgar Cano on 2017-04-14 08:13:49 -0500 commented: Thank you for your comments. The sidewalk is on private property and the responsibility of the property owner. Thank you for using 311. Privater Property 2533056 Caller is requesting to participate in the sidewalk replacement program. Caller advised that there are two-three sidewalk squares in need of replacement. Caller is requesting information on this program. 2509 Thayer Street, Evanston, IL, United States Jennifer Levi on 2017-04-18 11:52:53 -0500 commented: A 50/50 Participation Letter was mailed to the 2509 Thayer on March 27, 2017. In the event that you did not receive it, I have place another letter in the mail and I have also attached a copy. This letter will give you more information on the 50/50 Sidewalk Replacement Program. Thank you for using 311! Edgar Cano on 2017-04-14 13:43:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2534386 Caller is interested in participating in the 50/50 Sidewalk Replacement Program and stated that there are 3-4 squares in need of replacement. Caller is requesting information. 1560 Asbury Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-20 14:26:38 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail, email, and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-17 07:20:23 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2536351 1407 Dobson Street, Evanston, IL, United States Edgar Cano on 2017-04-18 14:55:50 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2543436 Resident would like a quote for sidewalk replacement. 1461 Florence Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-20 14:16:03 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail, email, and has been attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2545280 We repaired uplifted bricks around trees on the North side of Emerson between Oak and Maple ave. Can someone please inspect them to make sure the sidewalk is ok? Thank you 900 Emerson Street, Evanston, IL, United States Jennifer Levi on 2017-04-20 14:07:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 341 of 549 Id Description Address Comments Type 2547862 On the north east corner of Girard and Isabella. Caller is interested in having the sidewalk on the south and west sides of the property evaluated. 2801 Girard Avenue, Evanston, IL, United States Jennifer Levi on 2017-04-21 11:02:41 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email, postal mail, and has been attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-20 15:08:52 -0500 commented: The sidewalk has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2548264 Resident is requesting a quote for the 50/50 program. 2517 Lincoln Street, Evanston, IL, United States Jennifer Levi on 2017-04-20 12:38:42 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail, email and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2552295 Caller is interested in participating in the 50/50 Sidewalk Replacement Program and advised there are 3-4 squares in need of replacement. 3147 Grant Street, Evanston, IL, United States Jennifer Levi on 2017-04-21 11:17:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email, postal mail, and is attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-21 07:38:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2561811 Caller is requesting to participate in the 50/50 Sidewalk Replacement Program. Caller advised that there is one square that it uneven and is a trip hazard. Caller is requesting that the square be replaced. 2037 Brown Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:57:46 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-24 14:22:28 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562114 I would like to participate in the sidewalk repair program. My address is 912 Crain, Unit A. Catherine Bourke. 912 Crain Street, Evanston, IL, United States Henry Daniels on 2017-04-26 07:56:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-24 14:21:16 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562297 Property owner is requesting to participate in the 50/50 sidewalk program. 1223 Pitner Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:54:55 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-24 14:20:06 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562497 711 Madison St, Evanston, IL 60202, USA Henry Daniels on 2017-04-26 07:54:29 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:33:07 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562578 the side walk is crumbling and slightly sinking on my walkway and I'm afraid someone will trip. 1008 Brummel St, Evanston, IL 60202, USA Edgar Cano on 2017-04-25 15:32:00 -0500 commented: Thank you for your comments. The sidewalk was inspected and found to be on private property. Thank you for using 311. Privater Property 2562940 3041 Hartzell St, Evanston, IL 60201, USA Henry Daniels on 2017-04-26 07:53:46 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:52:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562981 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that about nine slabs need to be replaced. 540 Hinman Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:53:20 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:50:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 342 of 549 Id Description Address Comments Type 2562985 Resident is requesting to participate in the 50/50 Sidewalk Replacement Program. Resident advised that "Two to four squares with crumbling could use replacing or repair." 3055 Park Place, Evanston, IL, United States Rose Shilling on 2017-05-25 14:14:00 -0500 commented: Hello. While the crumbling sidewalk sections were patched at my house, I'm afraid I did not receive the Participation Letter attachment by email or mail. If the letter is attached to the comment in the 311 system, I'm having trouble seeing it. Could someone help me out with retrying to send the letter (if I'm not too late)? Henry Daniels on 2017-04-26 07:52:57 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:49:43 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2562986 Caller would like to participate in the 50/50 program. 2401 Lake Street, Evanston, IL, United States Henry Daniels on 2017-04-26 07:52:30 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:48:50 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2563294 Property owner requesting to participate in the 50/50 Sidewalk Replacement program. 1113 Ashland Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:52:13 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:47:20 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2563375 Property owner requesting participation in the 50/50 sidewalk replacement program for approximately six slabs. 2343 Ridge Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:51:18 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:46:26 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2563896 Would like to participate in the 50/50 program. Address is 2767 girard avenue. 2767 Girard Ave, Evanston, IL 60201, USA Jennifer Levi on 2017-04-25 13:58:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:43:25 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2564518 Caller is interested in participating in the 50/ 50 Sidewalk Replacement Program. Caller advised that there are three squares in need of replacement. 1036 Darrow Ave, Evanston, IL, United States Henry Daniels on 2017-06-09 16:14:58 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Angel Delgado (311) on 2017-06-08 17:22:58 -0500 commented: Caller would like to know if the request to participate in the 50/50 sidewalk repair program was properly received? I thought that I had correctly signed up for the program on-line, but after talking to some neighbors, I feel I may not have done so properly. Henry Daniels on 2017-04-26 07:49:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 08:02:11 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2565114 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that five slabs need to be replaced. 1113 Hull Terrace, Evanston, IL, United States Henry Daniels on 2017-04-26 07:49:03 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 11:30:58 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 343 of 549 Id Description Address Comments Type 2565436 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that two slabs are in need of replacement. 1027 Greenwood Street, Evanston, IL, United States Henry Daniels on 2017-04-26 07:48:43 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 11:30:22 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2565688 Resident is requesting a sidewalk evaluation, and she would like to be placed on the 50/50 sidewalk replacement program. 1501 Mcdaniel Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:48:13 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 11:29:03 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2566096 2735 Simpson Street, Evanston, IL, United States Henry Daniels on 2017-04-26 07:47:51 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:40:40 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2566560 Resident is requesting an evaluation for the for the sidewalk on the Cleveland side of her house. 622 Ridge Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 07:47:28 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:42:04 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2566833 Resident requesting participation in the 50/50 sidewalk program. 1317 Judson Avenue, Evanston, IL, United States Henry Daniels on 2017-10-17 07:18:27 -0500 commented: Program information has been sent directly to attached email. Beverly Otey (311) on 2017-10-09 14:13:13 -0500 commented: Resident called to ask about when the sidewalk would be replaced as part of the 50/50 program. She reports she did not receive the Participation letter that was sent in April. She would like to be included in the program and is asking for the letter to be resent to her. Henry Daniels on 2017-04-26 07:47:01 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:42:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2567076 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. 1515 Judson Ave, Evanston, IL, United States Henry Daniels on 2017-04-26 07:46:36 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:44:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2567277 Caller is requesting to participate in the 50/50 Sidewalk Replacement Program. Caller is requesting an Evaluation. 1009 Dewey Ave, Evanston, IL, United States Henry Daniels on 2017-04-26 07:46:02 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:39:32 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2567297 We repaired one slab a couple years ago but it is again breaking apart. There is another slab that is falling and now sits below the slab next to it creating a small step that could cause issues. 2016 Noyes St, Evanston, IL 60201, USA on 2017-05-17 13:41:08 -0500 commented: I still have not received the 50/50 letter. I do not see it in my email nor attached to this comment. Can you resend it? Henry Daniels on 2017-04-26 07:45:22 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:38:47 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 344 of 549 Id Description Address Comments Type 2567306 We have 5 or 6 slabs that need to be repaired/replaced. Thank you. 3206 Hartzell St, Evanston, IL 60201, USA Henry Daniels on 2017-04-26 07:43:57 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:38:02 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2567609 2026 Harrison St, Evanston, IL 60201, USA Henry Daniels on 2017-04-26 07:43:39 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:37:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2569081 We seem to have 3 sections that need to be replaced and would like to participate in the 50/50 program to have them replaced. 1111 Mulford St, Evanston, IL 60202, USA Henry Daniels on 2017-04-26 07:40:29 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 06:45:33 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2569233 Probably 6 squares to be replaced as part of the 50/50 program. 1202 Dewey Ave, Evanston, IL, United States Henry Daniels on 2017-04-26 08:49:24 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 08:00:39 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2570274 Caller is interested in participating in the 50/50 Sidewalk Replacement Program and advised that there are two slabs in need of Replacement on the Ewing side of this corner lot. 2741 Simpson Street, Evanston, IL, United States Henry Daniels on 2017-09-15 19:02:45 -0500 commented: Met with Doris today and did evaluation. Henry Daniels on 2017-09-11 15:58:43 -0500 commented: Left phone message for Doris and sent email link to participation form. Beverly Otey (311) on 2017-09-11 09:10:53 -0500 commented: Doris Brown reported she submitted the 50/50 Participation letter, but has not heard from anyone regarding the replacement. Caller reports she will be out of town next week for 2 weeks and would like to get this resolved before leaving town. Ms Brown also stated she called 2 weeks ago and left a voice message. She has not received a call back. SDO transferred the caller to Henry Daniels voice mail. Henry Daniels on 2017-04-26 14:58:31 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 11:02:40 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2570337 Caller is inquiring about participating in the 50/50 Sidewalk Replacement Program. Caller advised that there are 5-6 slabs in need of replacement. 1403 Maple Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 14:59:35 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 11:01:53 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2570548 Resident would like to be added to the 50/50 sidewalk replacement program. 2648 Reese Avenue, Evanston, IL, United States Henry Daniels on 2017-04-26 15:00:45 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 12:39:43 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2570741 Caller is interested in participating in the Sidewalk Replacement Program and advised that there are about 3 slabs in need of replacement. 2701 Harrison St, Evanston, IL, United States Henry Daniels on 2017-04-26 15:01:20 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 12:41:09 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 345 of 549 Id Description Address Comments Type 2572628 Caller is requesting a sidewalk evaluation and would like to be added on the 50/50 program. 810 Simpson Street, Evanston, IL, United States Henry Daniels on 2017-04-27 07:54:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 07:21:41 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2572911 2711 Asbury Ave,Evanston, IL 60201 Henry Daniels on 2017-04-27 07:53:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 07:22:41 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2573317 A portion of our sidewalk is sinking and we would like to participate in the 50/50 sidewalk replacement program to fix the issue. Please let me know how we can be part of this wonderful program. Thank you! 2115 Dewey Ave, Evanston, IL 60201, USA Henry Daniels on 2017-04-27 07:53:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 07:24:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Andriano Galvao on 2017-04-26 21:34:22 -0500 commented: The problem described above is in front of the gate. Rain water is ponding in that area and is a safety hazard for pedestrians. 50/50 Program 2574230 Caller states the her sidewalk is extremely broken. 1009 Dewey Ave, Evanston, IL, United States Henry Daniels on 2017-04-27 15:28:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 15:00:41 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2574382 Wants to participate in the 50/50 program. Has 10-12 squares to replace. 2418 Payne Street, Evanston, IL, United States Linda Walker on 2017-04-27 16:53:52 -0500 commented: I do not see the Sidewalk Participation Letter. Did you forget to attach it, or am I just missing something? Thank you. Henry Daniels on 2017-04-27 15:28:38 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 10:28:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2575124 Caller is requesting an evaluation on the 3 slabs that are between the parkway and the curb. 942 Grey Avenue, Evanston, IL, United States Henry Daniels on 2017-04-28 15:12:12 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:26:23 -0500 commented: Thank you for your comments. The homeowner is responsible for the upkeep of and repairs to the carriage walks. The city could do the repairs through the 50/50 program but the full cost would be paid by the homeowner. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2575380 I want to participate in the 50/50 sidewalk replacement program. please enroll me in the program. II live at 1414 Forest Ave. I have one square that needs too be replaced. 1414 Forest Avenue, Evanston, IL, United States Henry Daniels on 2017-04-27 15:29:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 14:48:03 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2575406 I would like to know how much of the sidewalk is truly in need of replacement and approx. cost to me. Thank you. 904 Colfax St, Evanston, IL 60201, USA Henry Daniels on 2017-04-27 15:29:29 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 14:51:47 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 346 of 549 Id Description Address Comments Type 2576582 Caller would like to participate in the 50/50 sidewalk program. 2818 Lake Street, Evanston, IL, United States Henry Daniels on 2017-04-27 15:29:54 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-27 15:03:03 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2576627 I, Philip Schlak, am the homeowner. I would like the city to evaluate our sidewalk. Thank You! 414 Wesley Ave, Evanston, IL 60202, USA Henry Daniels on 2017-04-28 15:16:45 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:39:15 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2576633 Request for evaluation and participation in the 50/50 program for sidewalk replacement 2108 Cleveland St, Evanston, IL 60202, USA Henry Daniels on 2017-04-28 07:43:07 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:47:02 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2576688 I'd like to participate in the 50/50 Sidewalk Replacement Program. 921 Madison St, Evanston, IL 60202, USA Henry Daniels on 2017-04-28 08:56:52 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Trinda Weaver on 2017-04-28 08:50:37 -0500 commented: I meant Henry.Daniels Trinda Weaver on 2017-04-28 08:48:32 -0500 commented: Henry.Cano, do you mean the letter was mailed to my address? I do not see a letter attached to your comment. Henry Daniels on 2017-04-28 07:44:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:48:59 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2576796 Caller wants to participate in the 50/50 sidewalk program 150 Ashland Avenue, Evanston, IL, United States Henry Daniels on 2017-04-28 07:44:37 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:49:54 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2576815 Property owner requesting participation in the 50/50 Sidewalk Replacement program. The slabs are located on the Lincolnwood Drive side of the property. 2913 Harrison St, Evanston, IL, United States Henry Daniels on 2017-05-26 09:17:10 -0500 commented: Send participation letter separate by email. Henry Daniels on 2017-04-28 07:44:59 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:50:32 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2577045 I made a request but message came back saying would mail info to address. also your message had wrong inspection address. please check 2018 lake st. I'm a landlord not living at property. please mail to look properties, Po box 35, golf, il 60029. or email lookpropertiesllc@gmail.com 2018 Lake Street, Evanston, IL 60201, USA John Benson on 2017-05-01 14:34:01 -0500 commented: Mr Daniels, does that mean you sent letter with next steps to look properties , Po box 35, golf, il ? thanks, John Benson, Manager Henry Daniels on 2017-04-28 07:46:34 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:52:06 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 347 of 549 Id Description Address Comments Type 2577116 Caller would like to sign up for the 50/50 program. 3210 Harrison St, Evanston, IL, United States Henry Daniels on 2017-04-28 07:47:56 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:53:11 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2577581 We have some uneven slabs in front of our house on 1334 Asbury. Could you investigate and let us know what we should consider? Thank you 1334 Asbury Ave, Evanston, IL 60201, USA Henry Daniels on 2017-04-28 15:16:24 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:36:38 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. on 2017-04-28 09:55:15 -0500 commented: There also is a single broken slab between the sidewalk and street on our Greenwood (near our gate in Greenwood). Thank you. 50/50 Program 2577653 I would like to receive an estimate in the 50/50 program. The buckling sidewalk is on Lee Street from the NW corner of Sheridan Road. Water also accumulates in the area farther west from Sheridan and near the alley. 1000 Sheridan Rd, Evanston, IL 60202, USA Henry Daniels on 2017-04-28 07:48:15 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:54:39 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2577726 Request to have our sidewalk evaluated to participate in 50/50 sidewalk program. 903 Ridge Ct, Evanston, IL 60202, USA Henry Daniels on 2017-04-28 07:42:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 06:55:22 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2578640 Caller is inquiring about having sidewalk slabs placed as a path from the street to sidewalk through the parkway. 709 Asbury Avenue, Evanston, IL, United States Henry Daniels on 2017-04-28 15:15:31 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:09:36 -0500 commented: Location was inspected and found that there currently is no carriage walk at that location. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2580335 This is an open lot next to the house at 2740 Eastwood. Sidewalk by the open lot needs 3 squares replaced. Wants to participate in 50/50 program. 2736 Eastwood Avenue, Evanston, IL, United States Henry Daniels on 2017-04-28 15:14:58 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:06:51 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2580657 There are 3 squares that have low spots that collect water and freezing in the winter. 312-314 South Boulevard, Evanston, IL, United States Henry Daniels on 2017-04-28 15:12:39 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 15:06:50 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2582271 One crumbling square of sidewalk on Reese Ave. side of house. 2831 Hartzell St, Evanston, IL 60201, USA Henry Daniels on 2017-05-01 07:05:06 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 06:54:52 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 348 of 549 Id Description Address Comments Type 2582502 I want to participate in the 50/50 sidewalk program. Please let me know next steps. regards Peter Mattox 847-226-2782 2531 Hastings Ave, Evanston, IL 60201, USA Henry Daniels on 2017-05-15 07:23:52 -0500 commented: Information resent 5-13-17 Peter Mattox on 2017-05-13 14:18:01 -0500 commented: hi - I have not yet received the letter that is referenced. Please re-send, or can you send the text via e-mail? Henry Daniels on 2017-05-01 07:04:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 06:54:11 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2582602 I live on a corner in Evanston so there is a LOT of sidewalk around my house. There are a couple of places where the squares of sidewalk have shifted. They aren't cracked and need replacement; but they are places someone (like me!) could easily trip because of the difference in height. Maybe just some asphalt (?) could smooth out the height differences? 2134 Wesley Avenue, Evanston, IL, United States Henry Daniels on 2017-05-05 08:00:27 -0500 commented: This location has been mitigated and the only other options for repairs is the City 50/50 Program or by the homeowner paying attention to the positioning of the downspouts form the property and its effect currently is the cause of the sidewalk panels sinking. Beverly Otey (311) on 2017-05-01 09:35:11 -0500 commented: Deb Bailey called to report that she is not interested in the 50/50 programs as the sidewalk squares are not broken, but are uneven due to the sidewalks sinking. Caller is asking for asphalt to be used to make the walk level. Henry Daniels on 2017-05-01 06:59:02 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 06:53:31 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2582903 I would like to request participation in the 50/50 Sidewalk & Curb Replacement Program. Thank you for your time! 2413 Hartrey Ave, Evanston, IL 60201, USA Henry Daniels on 2017-05-01 06:58:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 06:51:52 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2585143 In front of house is one square on Prospect and 2 more on Hartzell 2612 Prospect Avenue, Evanston, IL, United States Henry Daniels on 2017-05-01 09:04:24 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 08:56:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2585498 Property owner requesting participation in the 50/50 sidewalk replacement program. 1506 Wesley Avenue, Evanston, IL, United States Henry Daniels on 2017-05-01 15:27:02 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 10:11:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2586253 1300 Central Street Condo Association would like to participate in the 50/50 sidewalk replacement program. We have three pieces of sidewalk that need to be replaced. Thanks! 1300 Central St, Evanston, IL 60201, USA Henry Daniels on 2017-10-06 11:29:50 -0500 commented: 5 squares charged to 50/50 and 3 squares charged to tree damage. Jesse McPhail(311) on 2017-10-06 10:23:17 -0500 commented: Caller advised that the building owner agreed to split the cost of 5 slabs in front of the building but 8 have have been marked. Caller want to be sure the building will not be charged for more than 5 slabs. Henry Daniels on 2017-05-01 15:37:58 -0500 commented: The letter is above in the attached file, just click on it to open. Lauren Jankovec on 2017-05-01 15:30:51 -0500 commented: I would appreciate a copy of the letter to be sent to my office at: Wesley Realty Group 832 Custer Ave. Evanston, IL 60202. Not clear on if the letter was sent to 1300 Central or my office. Henry Daniels on 2017-05-01 15:27:31 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 12:17:14 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 349 of 549 Id Description Address Comments Type 2586274 Resident is requesting an evaluation of the parkway sidewalk. 2746 Broadway Avenue, Evanston, IL, United States Henry Daniels on 2017-05-01 15:29:22 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 14:36:54 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2586442 Resident is requesting a sidewalk evaluation of the area by the curb. 1705 Madison Street, Evanston, IL, United States Henry Daniels on 2017-05-01 15:30:07 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 12:18:27 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2587400 The sidewalk is in front of this address. 1 or 2 that are in bad shape. 2200 Lincolnwood Drive, Evanston, IL, United States Henry Daniels on 2017-05-01 15:30:35 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 14:38:03 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2587482 Caller is interested in the 50/50 sidewalk program 1333 Maple Avenue, Evanston, IL, United States Henry Daniels on 2017-05-01 15:31:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-01 14:28:06 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2587565 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller is requesting more information. 2128 Forestview Rd, Evanston, IL, United States Edgar Cano on 2017-05-01 14:26:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2590347 Resident is requesting a sidewalk evaluation and would like to be placed on the 50/50 program. 2012 Hawthorne Lane, Evanston, IL, United States Henry Daniels on 2017-05-02 09:47:40 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-02 08:47:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2591158 Sidewalk has a big crack and a slope that accumulates water. 1806 Oakton Street, Evanston, IL, United States Henry Daniels on 2017-05-03 15:09:10 -0500 commented: Marked main sidewalk squares 5/3/17 11:49 am. Henry Daniels on 2017-05-02 10:49:35 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-02 10:35:39 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2591575 Reported to 311 via SnapEngage Chat. "There are 8 sections btween my neighbor's updated walk to the north, and our driveway to the south. Perhaps they can just be raised, but if we're replacing them i don't think we want to do all 8 this spring...too much $$. Maybe just the 4 that are right in front of our house? Also, there are some REALLY uneven ones further north on the 1700 block, they're not safe for wheelchairs." 1720 Wesley Avenue, Evanston, IL, United States Henry Daniels on 2017-05-03 07:34:58 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-02 11:10:53 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2591967 The sidewalk that is in front of my house is cracked and buckled due to tree roots. The crack causes a 2-3 inch height difference, which is a tripping hazard. 2751 Broadway Ave, Evanston, IL 60201, USA Henry Daniels on 2017-05-05 07:21:04 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-04 11:42:19 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 350 of 549 Id Description Address Comments Type 2595803 Requesting participation in the 50/50 sidewalk replacement program. 725 Wesley Ave, Evanston, IL 60202, USA Henry Daniels on 2017-05-03 11:04:58 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-03 09:40:30 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2601544 Caller states they would like to participate in the sidewalk 50/50 program. They flood in a portion where it dips. 1319 Chicago Avenue, Evanston, IL, United States Henry Daniels on 2017-05-05 07:29:08 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-04 11:34:32 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2601601 Resident would like to be added to the 50/50 program. 2950 Payne Street, Evanston, IL, United States Henry Daniels on 2017-05-05 07:30:35 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-04 11:33:55 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2602212 Reported to 311 via Snap Engage Chat. "The sidewalk in front of 1517 Seward Street has been buckling and cracking for the 17 years that I have lived here. (I live two doors down from 1517.) I know about the 50/50 program, but I have also heard that if the sidewalks are bad enough, the city will pay entirely for the repairs. If this is so, these sidewalk panels are a good candidate for this." 1517 Seward Street, Evanston, IL, United States Henry Daniels on 2017-05-05 12:03:43 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-04 13:00:15 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2602365 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that there are three slabs in need of replacement. 2604 Sheridan Road, Evanston, IL, United States Henry Daniels on 2017-05-05 07:33:41 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-04 13:15:53 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2602758 820 Mulford Street, Evanston, IL, United States Henry Daniels on 2017-05-05 15:49:08 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 14:52:51 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2603193 Sent from 311 Web Chat. There are two very cracked sidewalk squares and several adjacent squares that are very low and thus collect water and freeze heavily in the winter. 2724 Harrison St, Evanston, IL, United States Henry Daniels on 2017-05-05 15:49:48 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 14:54:01 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2603868 Please include two slabs at north end of property in the 50/50 sidewalk replacement program. 2509 Prospect Ave, Evanston, IL 60201, USA Henry Daniels on 2017-05-05 07:35:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 07:23:28 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 351 of 549 Id Description Address Comments Type 2604410 30 squares in front of the property need replacement. 1856-1866 Sherman Ave Henry Daniels on 2017-05-12 07:29:43 -0500 commented: Mailed to Management Co. 5/8/17 Sherman Garden Apts 5215 Old Orchard Rd Skokie, IL 60076 Henry Daniels on 2017-05-05 07:37:34 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 07:24:31 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2604613 Resident has replaced his sidewalk late February/early March and would like to see if he can participate in the 50/50 program and get a partial reimbursement . 1604 Lincoln Street, Evanston, IL, United States Henry Daniels on 2017-05-23 07:21:53 -0500 commented: Utilizing the City's 50/50 Sidewalk Replacement Program is the only way to have taken advantage of the program's services. Henry Daniels on 2017-05-05 08:48:12 -0500 commented: B Nash to survey location for best solution. Henry Daniels on 2017-05-05 08:37:49 -0500 commented: Spoke with Mark 5-5-17 8:32 am. Will discuss with Rajeev Dahal. 50/50 Program 2605122 Hello-I live at 2507 Hurd Av and we have two square of our sidewalk in need of replacement/repair. We would like to participate in the 50/50 program. 2507 Hurd Avenue, Evanston, IL, United States Lolla Chimitris on 2017-05-06 10:25:42 -0500 commented: So I can see my sidewalk was patched with a black substance-is that a temporary fix prior to replacement or a more aesthetically pleasing repair? Or is that the final fix? Also, will I be receiving an estimate of the total cost before further work is done? Thank you for your time. Henry Daniels on 2017-05-05 11:02:22 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 10:58:48 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2605248 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that there is approx. one slab in need of replacement. 2323 Brown Avenue, Evanston, IL, United States Henry Daniels on 2017-05-05 11:02:42 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 10:57:39 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2608652 We would like to participate in the City's 50/50 Sidewalk Replacement because we have a section of sidewalk that has sunken down about three inches at on end, enough that pedestrians and bicycles have trouble getting over it going in one direction. 931 Wesley Avenue, Evanston, IL, United States Henry Daniels on 2017-05-08 16:41:50 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 06:48:46 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2611100 3 slabs 2112 Washington St, Evanston, IL, United States Henry Daniels on 2017-05-08 16:58:29 -0500 commented: correct email address is: lmoore01@peoplepc.com Henry Daniels on 2017-05-08 16:46:49 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 10:29:25 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2611211 Interested in 50/50 program. 2228 Central Street, Evanston, IL, United States Henry Daniels on 2017-05-09 14:15:18 -0500 commented: Street address is 2228 Central Park Ave Henry Daniels on 2017-05-08 16:47:36 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 10:28:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2611793 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller is also interested in having the curbs evaluated for replacement. 3516 Hillside Road, Evanston, IL, United States Henry Daniels on 2017-05-08 16:48:42 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 10:26:23 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 352 of 549 Id Description Address Comments Type 2612207 We would like to participate in the 50/50 Sidewalk Replacement program this spring. Thank you, and please let us know next steps. The Leonards 2315 Lincolnwood Dr, Evanston, IL 60201, USA Henry Daniels on 2017-05-08 16:49:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 10:37:00 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2613393 Caller would like to participate in the 50/50 program. 2231 asbury Henry Daniels on 2017-05-08 16:50:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 13:26:59 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2614760 Caller would like to participate in the 50/50 sidewalk program. 2231 Asbury Avenue, Evanston, IL, United States Henry Daniels on 2017-05-09 13:47:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 06:49:28 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2615306 Caller wants to be a part of the 50/50 program. There are 10 squares on the Lyons side of the property. 1801 Asbury Avenue, Evanston, IL, United States Henry Daniels on 2017-05-09 13:48:13 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 06:48:34 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2617359 Caller would like to participate in the 50/50 sidewalk replacement program. 1737 Mcdaniel Avenue, Evanston, IL, United States Henry Daniels on 2017-05-11 07:28:26 -0500 commented: No problem. If you don't mind me asking, why you have opted to not participate in the 50/50 Sidewalk program? Angel Delgado (311) on 2017-05-10 10:58:59 -0500 commented: Caller would like to be removed from the list. Henry Daniels on 2017-05-09 13:56:21 -0500 commented: A 50/50 Sidewalk Participation Letter has been attached in file. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 12:09:04 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2617598 7 slabs need evaluation: front of house Slanted and collecting water: needs replacing. 2130 Forestview Rd, Evanston, IL, United States Henry Daniels on 2017-06-08 09:26:10 -0500 commented: Resent letter by mail. Beverly Otey (311) on 2017-06-07 13:11:37 -0500 commented: Resident called for a follow up. SDO reported that a letter had been sent via email. She will look to see if she received the information. Henry Daniels on 2017-05-09 13:59:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 12:10:25 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2619090 TEST 2100 Ridge Avenue, Evanston, IL, United States Henry Daniels on 2017-05-09 14:28:55 -0500 commented: A 50/50 Sidewalk Participation Letter has been attached in file. The letter will explain the next steps that need to be taken. Thank you for using 311! Henry Daniels on 2017-05-09 14:00:57 -0500 commented: This location ha been added the Streets Department list for mitigation inspection. Transferred to Engineering to follow up with 50/50 Cost Share program. 50/50 Program 2619186 This is a corner property and the sidewalk on Lawndale and Hartzell needs to be evaluated. Caller reports 15-16 squares. 3056 Hartzell Street, Evanston, IL, United States Henry Daniels on 2017-05-10 07:52:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 15:11:41 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2619233 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller is requesting more information. Additionally Caller advised that there used to be sidewalk squares on the parkway between the street and sidewalk but were removed a few years ago. Caller is requesting that these squares be reinstalled. 1014 Brummel Street, Evanston, IL, United States Henry Daniels on 2017-05-11 07:31:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address tseldess@hotmal.com. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-09 15:12:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 353 of 549 Id Description Address Comments Type 2620658 TEST 2100 Ridge Avenue, Evanston, IL, United States Henry Daniels on 2017-05-10 07:26:25 -0500 commented: A 50/50 Sidewalk Participation Letter has been attached in file. The letter will explain the next steps that need to be taken. Henry Daniels on 2017-05-10 07:24:55 -0500 commented: This location ha been added the Streets Department list for mitigation inspection. Transferred to Engineering to follow up with 50/50 Cost Share program. Akilah Hagler (311) on 2017-05-09 17:52:59 -0500 commented: Hank this is another test. Please attach the documents as you did on the previous request. 50/50 Program 2621525 Information from 311 Web Chat. We would like to participate in the 50/50 sidewalk fix. There is a slab outside in front of our house that is cracking and not level. Water tends to pool in it in the summer and ice forms in the winter. 2420 Brown Avenue, Evanston, IL, United States Henry Daniels on 2017-05-11 07:32:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-10 11:17:04 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2624552 Resident would like to be added to the 50/50 program. 133 Clyde Avenue, Evanston, IL, United States Henry Daniels on 2017-05-11 07:37:31 -0500 commented: Dear Property Owner: This letter is to provide you with an update regarding the City’s 50/50 Sidewalk Replacement Program. If you are interested in participating in the program, please identify the sidewalk to be replaced by marking it with a spray painted dot or X. After marking selected sidewalk(s), please go online to www.cityofevanston.org/5050 by typing this link in the address bar to fill out our online form. By completing the form, Hank Daniels will be notified to measure the area identified for sidewalk(s) removal and replacement. Invoices will be mailed out after locations have been verified and quantities have been tabulated, likely in early May. Immediately upon receipt of the City’s invoice for the work, you should remit full payment to the City prior to the due date on the invoice. The Contractor will begin work once the City has received payments from property owners, likely in June. Prior to excavation, sprinkler systems installed in the public R.O.W. should be identified with a marking/flag by the owner to prevent damage. The Contractor will backfill with black dirt after the completion of the concrete work. Seeding of this area will be the owner’s responsibility. De-icer should not be used on the new concrete for a period of one year after replacement. See the back of this letter for a list of 2017 50/50 Sidewalk Replacement Program Contract Costs and Frequently Asked Questions (FAQ’s). Please contact Hank Daniels at hdaniels@cityofevanston.org or at (847) 448-8172 if there are any additional questions. Sincerely, Rajeev Dahal Senior Project Manager 50/50 Program 2625068 Caller would like to participate in the 50/50 program. 515 Sheridan Square, Evanston, IL, United States Henry Daniels on 2017-05-11 07:38:04 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-11 06:50:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2626440 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that there are approx. 3-4 slabs in need of replacement. 3512 Hillside Road, Evanston, IL, United States John Parkes on 2017-05-11 15:26:18 -0500 commented: Very good Henry Daniels on 2017-05-11 13:19:08 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-11 12:52:36 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 354 of 549 Id Description Address Comments Type 2627461 One slab in front of this address that is about 1 inch lower than the rest of the sidewalk causing pooling of water and ice. 736 Clinton Place, Evanston, IL, United States Henry Daniels on 2017-05-11 13:32:35 -0500 commented: Email address is incorrect. Dear Property Owner: This letter is to provide you with an update regarding the City’s 50/50 Sidewalk Replacement Program. If you are interested in participating in the program, please identify the sidewalk to be replaced by marking it with a spray painted dot or X. After marking selected sidewalk(s), please go online to www.cityofevanston.org/5050 by typing this link in the address bar to fill out our online form. By completing the form, Hank Daniels will be notified to measure the area identified for sidewalk(s) removal and replacement. Invoices will be mailed out after locations have been verified and quantities have been tabulated, likely in early May. Immediately upon receipt of the City’s invoice for the work, you should remit full payment to the City prior to the due date on the invoice. The Contractor will begin work once the City has received payments from property owners, likely in June. Prior to excavation, sprinkler systems installed in the public R.O.W. should be identified with a marking/flag by the owner to prevent damage. The Contractor will backfill with black dirt after the completion of the concrete work. Seeding of this area will be the owner’s responsibility. De-icer should not be used on the new concrete for a period of one year after replacement. See the back of this letter for a list of 2017 50/50 Sidewalk Replacement Program Contract Costs and Frequently Asked Questions (FAQ’s). Please contact Hank Daniels at hdaniels@cityofevanston.org or at (847) 448-8172 if there are any additional questions. Sincerely, Rajeev Dahal 50/50 Program 2627674 Property owner requesting participation in the 50/50 sidewalk program. Damaged slabs include in front of 2202 Forestview and the slabs between neighboring property at 2204 Forestview. 2202 Forestview Road, Evanston, IL, United States Henry Daniels on 2017-05-11 13:27:28 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-11 12:56:27 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2627677 Caller reports 8-9 squares to be replaced. 3510 Hillside Road, Evanston, IL, United States Henry Daniels on 2017-05-11 13:29:42 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-11 12:54:46 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2630513 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that this property is on Sherman, Emerson, & University Place (1856-1866 Sherman Ave). Caller advised approx. 20 slabs need to be replaced. 1856 Sherman Avenue, Evanston, IL, United States Henry Daniels on 2017-05-12 07:33:45 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 07:25:58 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2630530 Information from 311 web chat requesting to be in the 50/50 program. 2710 Isabella Street, Evanston, IL, United States Henry Daniels on 2017-05-12 07:35:04 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 07:30:48 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2630692 Resident is requesting a sidewalk evaluation and would like to be added to the 50/50 program. 2754 Ewing Avenue, Evanston, IL, United States Henry Daniels on 2017-05-12 08:28:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 08:24:41 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2630943 Caller would like to be added to the 50/50 sidewalk replacement program. 727 Clinton Place, Evanston, IL, United States Henry Daniels on 2017-05-12 14:04:20 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 09:18:58 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 355 of 549 Id Description Address Comments Type 2631245 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that approx. 2-3 slabs need to be replaced. 2620 Central Park Avenue, Evanston, IL, United States Henry Daniels on 2017-05-12 14:05:50 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 12:28:24 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2632358 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that approx. 4 slabs need to be replaced. 746 Florence Avenue, Evanston, IL, United States Henry Daniels on 2017-05-12 14:06:39 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 12:32:38 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2633157 Reported via SnapEngage Chat to 311. "I would like to participate in the 50/50 Sidewalk replacement program. My address is 1212 Cleveland, 60202" 1212 Cleveland Street, Evanston, IL, United States Henry Daniels on 2017-05-12 15:34:10 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-12 15:22:15 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2633877 I have a couple of broken slabs and a couple of sunk slabs 2406 Park Pl, Evanston, IL 60201, USA Henry Daniels on 2017-05-17 10:06:42 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-15 06:54:53 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2634611 Reported via SnapEngage Chat to 311. "Would like to be part of the 50/50 sidewalk replacement plan for summer 2017 for the McGaw YMCA 1000 Grove Street, Evanston IL 60201." 1000 Grove Street, Evanston, IL, United States Henry Daniels on 2017-05-17 10:09:50 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-15 06:55:13 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2641041 Caller reports that two slabs were not properly regraded during the 2015 50/50 sidewalk program. Caller states she has reported this issue for the last two years, and it still has not been resolved. Caller advises that in the winter water freezes and causes an icy hazard at the two slabs. 1201 Judson Avenue, Evanston, IL, United States Henry Daniels on 2017-11-17 07:22:57 -0600 commented: 2nd round work completed, customer is interested in participating in the 2018 50/50 Sidewalk Program also, program information will be sent in the spring 2018. Henry Daniels on 2017-08-18 14:49:24 -0500 commented: Susan, Your location has added to the 2nd round of the 50/50 Sidewalk Replacement Program at no cost to you. This will be completed before winter. Thanks, Hank Jesse Ramsay (311) on 2017-08-15 10:34:14 -0500 commented: Caller advised that when the slab was replaced it was not properly graded and now water pools on the sidewalk. Caller advised that she spoke with someone who advised that the slab would be replaced at no cost to her. She would like the slab fixed before winter so that there is no issue with ice. Henry Daniels on 2017-05-23 07:52:32 -0500 commented: Spoke with Susan 5/23/17 7:50 am Henry Daniels on 2017-05-22 07:24:20 -0500 commented: This location will be added to the second round of the 50/50 Sidewalk Replacement Program at no charge to you. Edgar Cano on 2017-05-16 06:56:19 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2641539 Property owner is interested in repairing three sidewalk slabs through the 50/50 sidewalk replacement program. 414 Barton Avenue, Evanston, IL, United States Henry Daniels on 2017-05-17 10:12:54 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-16 06:57:39 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 356 of 549 Id Description Address Comments Type 2650616 Resident requesting to participate in the 50/50 sidewalk program. 2106 Dobson Street, Evanston, IL, United States Sandra Hernandez (311) on 2017-06-30 08:34:19 -0500 commented: Resident is requesting the email to be sent again. Henry Daniels on 2017-05-18 07:16:37 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-17 13:39:01 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2657812 I would like to repair the sidewalk from the first crumbling square all the way south to the property line for 929 Sherman Ave. There are 2 squares near the tree which were "repaired" by this program about 6 or 7 years ago but they are not level and water pools deeply, and in the winter it freezes and presents a serious hazard. 933 Sherman Ave, Evanston, IL 60202, USA Henry Daniels on 2017-05-22 07:52:23 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-19 07:20:43 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2660808 Hank Daniels stopped by and requested that we submit the form. Several slabs are raised and cracked. 3210 Hartzell St, Evanston, IL 60201, USA Henry Daniels on 2017-05-22 07:51:47 -0500 commented: Thank you for the follow up. 50/50 Program 2682901 I would like to participate in the 50/50 sidewalk program. There are several broken sidewalk sections in front of our home we wish to replace. Thank you. 2145 Pioneer Rd, Evanston, IL 60201, USA Henry Daniels on 2017-05-26 07:41:44 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-25 15:08:29 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2683429 2 slabs 1201 Chicago Avenue, Evanston, IL, United States Henry Daniels on 2017-05-26 07:43:10 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-25 15:14:51 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2684275 Caller to participate in the 50/50 program. 1436 Grey Avenue, Evanston, IL, United States Henry Daniels on 2017-05-26 07:44:22 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-25 15:16:26 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2687186 Resident would like to know if this is marked because it is going to be fixed? The sidewalk is raised by the curb due to parkway tree roots. Please see attached picture. 2402 Cowper Avenue, Evanston, IL, United States Edgar Cano on 2017-05-26 13:47:25 -0500 commented: Thank you for your comments. The markings are survey markings done for road repairs that will be performed by outside contractors which may include part of or all of the walkway. Thank you for using 311 Issue Resolved 2688677 3 slabs 533 Florence Avenue, Evanston, IL, United States Henry Daniels on 2017-05-31 13:03:13 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-26 15:12:10 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2692366 Big height difference. Our kids have been falling on this for years 1716 Oakton St,Evanston, IL 60202 Edgar Cano on 2017-05-30 14:42:56 -0500 commented: The sidewalk has been mitigated. Thank you for your comments and for using 311. Issue Resolved 2706874 Interested in 50/50 program - on west side of house. Cell phone - 224-688-3252 2113 Dobson Street, Evanston, IL, United States Henry Daniels on 2017-06-09 16:17:29 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-01 15:10:18 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2720781 Caller is reporting that the sidewalk squares on the parkway leading from the street to sidewalk and uneven and are a trip hazard. Caller is inquiring as to whether these can be repair/ leveled. Additionally Caller is reporting that there are a couple sidewalk squares in front of this address that are cracked. Caller is inquiring about having the squares replaced. 1131 Cleveland Street, Evanston, IL, United States Henry Daniels on 2017-06-09 16:19:16 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-05 10:59:35 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 357 of 549 Id Description Address Comments Type 2727071 Approximately seven slabs need to be replaced on the Harrison Street side of the property. Caller advises that the best time to call is 0700-1200. 2448 Marcy Avenue, Evanston, IL, United States Henry Daniels on 2017-06-09 16:21:41 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-06 10:19:38 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2729568 The side walk in front of the whole of the complex is being buckled by tree roots located in the parkway. In the summer this causes puddles and trip hazards and in the winter it causes pooling, ice, and slip hazards. 613B Custer Ave, Evanston, IL 60202, USA Henry Daniels on 2017-06-09 16:27:44 -0500 commented: Email address came back not found sending participant letter in mail. Henry Daniels on 2017-06-09 16:22:47 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-08 14:14:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2729977 Interested in 50/50 program. The slabs are directly in front of driveway. 3-4 slabs. 2833 Sheridan Place, Evanston, IL, United States Henry Daniels on 2017-09-01 16:08:23 -0500 commented: Clara, The second round of the 50/50 Program will start sometime in late September. Thanks, Beverly Otey (311) on 2017-08-29 10:22:52 -0500 commented: Clara Lukas called to ask when her sidewalk will be replaced. Henry Daniels on 2017-06-09 16:24:00 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-06 15:34:58 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2738129 This is NOT a sidewalk, but a parking pad. Resident states a city tree has roots that are causing his parking pad to buckle. He would like this evaluated. 944 Grey Avenue, Evanston, IL, United States Matthew Basile on 2017-07-14 15:32:58 -0500 commented: A Certified Arborist with the City Of Evanston Forestry Division inspected inspected the tree and found that it is in good condition and is not a candidate for removal at this time. If you would like to replace the cement pad you are free to cut some roots that are growing under the pad as long as it is not to the detriment of the tree. If replacing the concrete requires removal of large roots, please let us know so we can meet with you before the new pad is poured and we will re-evaluate the tree at that time to determine if removal may be necessary. Thank you for your concern for Evanston's urban forest and for using the City of Evanston 311 system. Kevin Ward on 2017-06-30 13:01:24 -0500 commented: Unable to inspect tree extending due date. Beverly Otey (311) on 2017-06-29 10:05:40 -0500 commented: Edward Harrison called to follow up on this request. SDO confirmed the request has been reassigned to forestry and was in process. Paul D'Agostino on 2017-06-16 08:06:28 -0500 commented: Due to storm damage from 6/15, extending due date 1 week. Yvette Hopson(311) on 2017-06-16 06:53:48 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Edgar Cano on 2017-06-08 11:21:41 -0500 commented: Streets department met with resident at location. Advised that the issue is with the tree and would like Forestry department to evaluate. Forwarded to Forestry. Thank you for using 311. Esmeralda Escobedo (311) on 2017-06-08 09:45:24 -0500 commented: Please refer to previous request #1289657 that was submitted on 12/10/2015. 50/50 Program 2740725 Caller would like to participate in the 50/50 sidewalk program. 3301 Hartzell Street, Evanston, IL, United States Henry Daniels on 2017-06-09 16:24:51 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-08 15:15:25 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2778790 requesting to be added to the 50/50 Sidewalk Repair program. sidewalk confront of my home (2121 Cleveland st) has been pushed down in two spots. significant puddles (and eventually ice slicks) now form in the rain. 440.574.7600 homewoner: Natan Lipton-Lubet. 2121 Cleveland Street, Evanston, IL 60202, USA Henry Daniels on 2017-06-21 06:58:23 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. Thank you for using 311! Edgar Cano on 2017-06-19 07:33:19 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 358 of 549 Id Description Address Comments Type 2780495 Caller is reporting that there is one damaged square in front of this address that pools water after if rains. Caller is inquiring as to what options she has in repairing or replacing the square. Caller would like to know the cost of the replacement through the 50/50 Sidewalk Replacement Program. 1210 Dewey Avenue, Evanston, IL, United States Henry Daniels on 2017-06-21 06:57:39 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. Thank you for using 311! Edgar Cano on 2017-06-19 12:53:10 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2783586 Caller would like information about participating in the 50/50 sidewalk program. Caller would like 3 squares replaced. 1313 Lake Street, Evanston, IL, United States Rosemary Nielsen on 2017-06-22 09:59:43 -0500 commented: Good Henry Daniels on 2017-06-21 06:56:12 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. Thank you for using 311! Edgar Cano on 2017-06-20 14:33:05 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2800123 Caller is from the business Heartwood, a medical business. She reports about a year ago there was construction done on the street that damaged the side walk in front of the parking lot used by the clients of Heartwood. The parking lot is East of 1818 Dempster, , next to the building at 1814 Dempster. The damaged sidewalk makes it difficult for the clients to walk from the parking lot to the business as many use walkers or wheelchairs. She is requesting the sidewalk be repaired as soon as possible. 1818 Dempster St, Evanston, IL, United States Edgar Cano on 2017-06-29 14:43:17 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Beverly Otey (311) on 2017-06-22 15:52:25 -0500 commented: Ms Floy also stated one of her clients fell out of her wheelchair today and suffered abrasions. SDO advised her to have the client contact the City's Legal Services to make a claim . Beverly Otey (311) on 2017-06-22 15:50:10 -0500 commented: Ms Floy stated she has contacted the city 5 times and left messages with various people regarding the damaged sidewalk Ms Floy was not certain if a request had been submitted or if she had left voice messages but she reported no one has contacted her. SDO did not find any service reqeusts regarding this issue. Ms Floy is very angry the city has not responded to her requests. She did not want me to enter a service request, but connect her to a live person who would take care of the issue. She was not certain what type of work or was done last year, so it is unclear which department she may have left messages for. At caller's request, the call was transferred to Jim Maiworm's Voice Mail. 50/50 Program 2817097 Caller would like an estimate in the 50/50 program. 1006 Darrow Avenue, Evanston, IL, United States Henry Daniels on 2017-07-05 07:00:15 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-27 12:13:56 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2827381 Caller is requesting a sidewalk evaluation for the sidewalk near the alley. 330 Barton Avenue, Evanston, IL, United States Henry Daniels on 2017-07-05 07:07:33 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-30 14:42:28 -0500 commented: Streets Department spoke with owner, they are interested in information for the 50/50 program. Transferred to the Capital Planning Bureau for information. Thank you for using 311. Esmeralda Escobedo (311) on 2017-06-29 10:15:58 -0500 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed for the 4th of July Holiday Tuesday 7/4/2017. City offices will re-open on Wednesday 7/5/2017. 311 is available on line 24/7 www.cityofevanston.org or please contact us at 311 or 847-448-4311 Monday 7/3/2017 7:00am - 7:00pm Tuesday 7/4/2017 7:00am - 10:00pm Wednesday 7/5/2017 7:00am - 7:00pm 50/50 Program 2842353 I'm requesting to participate in the 50/50 Sidewalk Replacement Program. I have two squares to replace: one on the extreme north end and one on the extreme south end of my property. My neighbors (north & south sides) will likely participate since they have adjacent sidewalk that is in disrepair too. Thanks, Martin Brandt 312.608.5244 2714 Woodbine Ave, Evanston, IL 60201, USA Henry Daniels on 2017-07-12 07:32:49 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! John Jaminski on 2017-07-06 07:05:13 -0500 commented: remediated 50/50 Program 359 of 549 Id Description Address Comments Type 2845478 My address is the corner of Central and Highland. The sidewalk needing repair is on Highland. It was repaired under the 50/50 program many years ago when I first moved in and has buckled, sunk and crumbled over the years since that repair. I would like to be on the list for repair. 3141 Central St, Evanston, IL 60201, USA Henry Daniels on 2017-07-12 07:37:06 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! John Jaminski on 2017-07-06 14:56:06 -0500 commented: remediated 50/50 Program 2846541 Caller wants a slab on the corner of Noyes and Grey. Caller does not want to participate in the 50/50 program and wants the city to repair the slab due to the roots pushing the slab up. 2026 Noyes Street, Evanston, IL, United States Henry Daniels on 2017-07-12 07:44:44 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Henry Daniels on 2017-07-12 07:43:41 -0500 commented: Your participation is required even though the cost is the city's responsibility. John Jaminski on 2017-07-07 14:56:56 -0500 commented: remediated 50/50 Program 2849252 Roots growing under sidewalk and it tilts causing water to collect and cause a hazard. Caller also advised that a large pile of black asphalt was placed on the sidewalk and is unsightly. 1033 Monroe Street, Evanston, IL, United States Henry Daniels on 2017-07-13 08:07:30 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2870006 Interested in 50/50 program - large parkway tree is causing sidewalk to buckle. (2) squares Actual address 470 - 498 Sheridan Road 470 - 498 Sheridan Road, Evanston, IL, United States Henry Daniels on 2017-07-13 08:13:57 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-11 09:06:02 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2876667 Caller is interested in 50/50 program. Approximately (5) slabs. 1118 Madison Street, Evanston, IL, United States Henry Daniels on 2017-07-13 08:22:25 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-12 06:53:27 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2879440 Caller interested in finding about about 50/50 2330 Grey Avenue, Evanston, IL, United States Henry Daniels on 2017-07-13 08:23:19 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-12 11:47:44 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2891285 Caller applied and paid a deposit on the 50/50 program and hasn't heard about any work starting. He is inquiring if there is a timeline for the work to start. 915 Michigan Avenue, Evanston, IL, United States Henry Daniels on 2017-07-25 17:29:58 -0500 commented: 50/50 contractor is in town this week 7/24/17. Your location is # 98 on the list. Sue Pontarelli on 2017-07-25 13:28:19 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli Yvette Hopson(311) on 2017-07-24 15:49:20 -0500 commented: Please review this request, it is overdue. Thanks, Yvette 50/50 Program 2896839 My tenant just sent me picks of the asphalt patching of sidewalk in front of my property. 1116 Monroe. I would much rather do the 50/50 program that I've done in the past. Although I done remember how long ago. I hope these aren't the same sidewalk sections. Mark Dziatkiewicz dzmark99@gmail.com 954-540-7603 1116 Monroe St, Evanston, IL 60202, USA Henry Daniels on 2017-07-25 17:31:16 -0500 commented: Thank you for using 311!A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Sue Pontarelli on 2017-07-25 13:28:13 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli 50/50 Program 2899796 Caller would like to participate in the 50/50 sidewalk program. 1213 Monroe Street, Evanston, IL, United States Henry Daniels on 2017-07-25 17:31:02 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Sue Pontarelli on 2017-07-25 13:27:45 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli Edgar Cano on 2017-07-17 12:05:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 360 of 549 Id Description Address Comments Type 2943090 Caller would like to participate in the 50/50 Sidewalk program 1728 Leland Avenue, Evanston, IL, United States Henry Daniels on 2017-08-01 19:52:54 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-26 13:59:49 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2952623 Caller would like to participate in the 50/50 program. Caller would like to know an average cost. 1028 Cleveland Street, Evanston, IL, United States Henry Daniels on 2017-10-16 11:29:35 -0500 commented: Joshua, Thank you for your participation and payment in the 50/50 Program. The 2nd round locations list has been given to the contractor and the will be proposing a schedule for approval. I estimate that construction will begin in two to thee weeks. A letter giving specifics will be sent to all participants when a date is agreed upon. Joshua Pick on 2017-10-16 08:43:21 -0500 commented: Hello, I paid for the sidewalk repair 2 weeks ago and wanted to know when the work will start. Thanks! Henry Daniels on 2017-08-01 19:52:23 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-28 11:41:50 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2960356 Resident advises after the slabs were just replaced through the 50/50 sidewalk, it now created a 2" rise between the sidewalk and the path that leads to the street. 1318 Cleveland Street, Evanston, IL, United States Henry Daniels on 2017-11-15 11:25:07 -0600 commented: Sidewalk issue has been resolved. Please note, you can also contact 311 directly during the hours of 7:00 a.m. to 7:00 p.m Monday - Friday by: Calling 3-1-1 or 847-448-4311 (Outside of Evanston) Texting 847-448-4311 Emailing 311center@cityofevanston.org Further details on the 311 Center are available 24/7 at www.cityofevanston.org/311 Henry Daniels on 2017-08-01 19:41:06 -0500 commented: The unintentional damage to the carriage walk has been noted and will be added to the second round for repair. Sorry for any inconvenience this may have caused. 50/50 Program 2972452 Resident at 612 A South Blvd, requesting to evaluate adding a courtesy walk and the cost. 612 South Blvd, Evanston, IL, United States Henry Daniels on 2017-08-03 14:16:26 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2990033 crack in one piece of pavement (maybe too small for repair); two larger areas where concrete is missing in another piece of pavement in front of 2215 Payne. Requesting evaluation for simple asphalt or 50/50 repair 2215 Payne St, Evanston, IL 60201, USA Henry Daniels on 2017-08-18 14:48:28 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Yvette Hopson(311) on 2017-08-18 13:24:27 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Edgar Cano on 2017-08-07 07:20:47 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3000931 Information from 311 webchat. Resident reports there are 7 slabs that need to be replaced. She requests a notice of the total cost prior to her participation in the 50/50/ programs. 1623 Crain Street, Evanston, IL, United States Henry Daniels on 2017-08-09 07:03:16 -0500 commented: A 50/50 Sidewalk Participation Letter was sent on 8/1/17 to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-09 06:51:05 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3012039 We need to replace 3 squares of sidewalk on the Hartzell street side of our lot. 2626 Ewing Ave, Evanston, IL 60201, USA Henry Daniels on 2017-08-18 14:46:03 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Yvette Hopson(311) on 2017-08-18 13:21:57 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Edgar Cano on 2017-08-11 12:54:26 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 361 of 549 Id Description Address Comments Type 3034308 I have three sections of sidewalk in front of our house that are in various states of deterioration. I would like to participate in the next 50/50 program. Please contact me for an evaluation. Charlie Walden 847.800.1647 2730 Lawndale Ave, Evanston, IL 60201, USA Henry Daniels on 2017-08-18 14:44:10 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-16 12:43:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3034988 Caller is requesting to be put on the list for the 50/50 program 2411 Ridgeway Avenue, Lincolnwood, IL, United States Henry Daniels on 2017-08-18 14:43:11 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-16 12:54:15 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3042222 Caller is interested in participating in the 50/50 Sidewalk Replacement Program. Caller advised that there are approximately four slabs in need of replacement. 1102 South Blvd, Evanston, IL, United States Henry Daniels on 2017-08-18 14:42:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-18 07:23:55 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3046059 Mrs. Bridges states her address is the only one on the block that does not have a sidewalk running from the curb to the city sidewalk. She is asking for someone form the city to contact her and come out so she can show them what she is referring to. 2000 Foster Street, Evanston, IL, United States Rajeev Dahal on 2017-08-25 15:53:20 -0500 commented: Reviewed the location. The walkway can be done as part of the 50/50 sidewalk project. Called and left a message for the resident to call me if she is interested in participating in the program. 50/50 Program 3049354 2426 Noyes St, Evanston, IL 60201, USA Henry Daniels on 2017-08-21 15:15:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-21 14:54:24 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3053025 Resident is requesting a sidewalk evaluation.2000 Foster Street, Evanston, IL, United States Edgar Cano on 2017-08-24 11:57:23 -0500 commented: Spoke with resident on 8/24/17. She is requesting a new walkway be installed in the parkway from the public walk to the street. She was informed that she could participate in the 50/50 program and have her request transferred over so that she can receive further information. She declined. Thank you for using 311. 50/50 Program 3064579 Resident advises that the construction work in the area caused damage to approximately six sidewalk slabs that are now not leveled. Resident would like information on replacing them, however, she is ok with also having grindings added to level the slabs. 2646 Reese Avenue, Evanston, IL, United States Henry Daniels on 2017-09-11 16:00:06 -0500 commented: Met with Norma today at location, will be sending invoice in next two weeks. Henry Daniels on 2017-09-07 13:24:01 -0500 commented: Sending resident 50/50 information. Henry Daniels on 2017-08-31 07:04:27 -0500 commented: Will call resident later today. Edgar Cano on 2017-08-23 10:24:24 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3085950 Caller is interested in participating in the 50/50 program. Her sidewalk is on the Isabella side. 2762 Woodbine Avenue, Evanston, IL, United States Henry Daniels on 2017-09-01 16:07:30 -0500 commented: Go to the link below and complete and submit the form. The second round of the 50/50 Program will start sometime in late September. www.cityofevanston.org/5050 Thanks, Edgar Cano on 2017-08-28 12:25:16 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3095454 sidewalk areas marked 2130 Forestview Rd, Evanston, IL 60201, USA Henry Daniels on 2017-09-07 12:36:14 -0500 commented: I will be out to your location this week. Edgar Cano on 2017-08-30 13:12:09 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3104987 Caller is interested in 50/50 sidewalk program.2639 Lincolnwood Drive, Evanston, IL, United States Henry Daniels on 2017-09-07 12:53:19 -0500 commented: Please fill out the form at the link below. www.cityofevanston.org/5050 Edgar Cano on 2017-09-01 07:18:14 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 362 of 549 Id Description Address Comments Type 3106539 Resident requesting participation in the 50/50 sidewalk replacement program. 2639 Lincolnwood Drive, Evanston, IL, United States Akilah Hagler (311) on 2017-09-01 08:10:00 -0500 commented: Multiple service requests have been submitted for this issue and they have all been merged into the following ticket number #3104987 to avoid duplication and improve service delivery. You will continue to be notified of the status of this work through the new ticket number #3104987. 50/50 Program 3118931 Resident would like a phone call from Streets supervisor. Resident advises that she had initially expressed interest in the 50/50 sidewalk replacement program. Resident advises that due to work by Nicor, the sidewalk slabs are being repaired. 2612 Prospect Avenue, Evanston, IL, United States Henry Daniels on 2017-09-07 13:18:41 -0500 commented: You have been removed from the list. Thank you for letting us know. Edgar Cano on 2017-09-05 12:36:26 -0500 commented: Spoke with resident via phone, 12:30 pm, 9/5/17. She would like to be taken off of the 50/50 replacement list. Transferring request to the 50/50 Program. Thank you for using 311. 50/50 Program 3120798 Resident would like a sidewalk evaluation and would like to be added to list. 3200 Thayer Street, Evanston, IL, United States Henry Daniels on 2017-09-07 13:19:31 -0500 commented: Please fill out the form by going to link below. www.cityofevanston.org/5050 Edgar Cano on 2017-09-07 12:50:09 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3127766 A big chunk of cement is missing on the sidewalk. Resident is requesting a sidewalk evaluation because multiple kids have fallen recently. 2727 Thayer Street, Evanston, IL, United States Henry Daniels on 2017-09-07 13:18:18 -0500 commented: Please fill out the form by going to link below. www.cityofevanston.org/5050 Edgar Cano on 2017-09-07 12:48:18 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3129506 Resident would like to be added to the 50/50 program. 2119 Sherman Avenue, Evanston, IL, United States Henry Daniels on 2017-09-07 13:16:52 -0500 commented: Please fill out the form by going to link below. www.cityofevanston.org/5050 Edgar Cano on 2017-09-07 12:18:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3135494 300 Dewey Avenue, Evanston, IL, United States Henry Daniels on 2017-09-12 14:46:37 -0500 commented: Sent 50/50 Sidewalk Replacement Program info letter today. Edgar Cano on 2017-09-12 14:39:01 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3176147 911 Maple Condominium Association, owners of 911-913 Maple Avenue, would like to participate in the 50/50 Sidewalk Replacement Program. We can be contacted at jleigh4@sbcglobal.net or 773-910-0605. Thank you. 913 Maple Ave, Evanston, IL 60202, USA Henry Daniels on 2017-09-15 08:23:55 -0500 commented: Sent info Edgar Cano on 2017-09-13 07:00:35 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3179758 Between 722-726 Madison there is 2 slabs that need replacement; he states that it is degrading and has become a trip hazard. 722 Madison Street, Evanston, IL, United States Edgar Cano on 2017-09-22 14:54:42 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Edgar Cano on 2017-09-20 14:55:23 -0500 commented: Area was inspected and has been scheduled for mitigation. Waiting on material from vendor. Tentatively scheduled for completion on 9/22/17. Thank you for using 311. Issue Resolved 3183579 Please ask the landscape contractor to return to 3147 Grant St. to further repair the parkway as a result of the water main replacement project. The area around the water connection to our property in the parkway adjacent to the new sidewalk section has collapsed, creating a potentially hazardous condition. Thank you. 3147 Grant St, Evanston, IL 60201, USA Angeleo Alonzo on 2017-09-14 11:25:55 -0500 commented: Informed the Contractor to resolve this situation. Also, left a voicemail to Suzanne that the Contractor will be back to fix it. Issue Resolved 3191820 Caller states that the tree next to 101 Grey (side of t hat address) has roots that are extended to the sidewalk and making it buckle. Caller states that the sidewalk has become a trip hazard. 101 Grey Avenue, Evanston, IL, United States Edgar Cano on 2017-09-22 15:17:40 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3198132 Caller says 4 or 5 squares that collect water and she would like them repaired or replaced. 2429 Lawndale Avenue, Evanston, IL, United States Henry Daniels on 2017-09-25 12:40:39 -0500 commented: Email came back un-deliverable, left phone message, and mailing information today. Henry Daniels on 2017-09-25 12:34:32 -0500 commented: 2017 50/50 Participation Letter was sent to email address. Edgar Cano on 2017-09-22 15:04:25 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3198525 Caller is interested in t he Sidewalk 50/50 program 2733 Thayer Street, Evanston, IL, United States Henry Daniels on 2017-09-19 11:30:33 -0500 commented: Information sent to email. Edgar Cano on 2017-09-18 10:40:26 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 363 of 549 Id Description Address Comments Type 3215139 Exit at Noyes L stop has been flooded for 2 days. A drain needs to be installed to drain water after rain. 2516 Railroad Ave,Evanston, IL 60201 Edgar Cano on 2017-09-25 09:52:19 -0500 commented: Area was inspected and found to be on CTA property. Thank you for using 311. Private Property 3219255 In the alley between 1005 Madison and 927 Madison, there are large metal plates that make a lot of noise when vehicles drive over them. Please replace the plates with pavement at the earliest possibility. 1005 Madison St, Evanston, IL 60202, USA Sylvie Romanowski on 2017-09-27 14:32:45 -0500 commented: Work was begun within 2-3 days, and the follow-up call to tell me the work was completed was most welcome. Also the man explained to me that RCN was mistaken in telling me that the city would repair. It was up to RCN to repair the pavement, not the city. I wish people would realize that Evanston is so responsive to its citizens. Kudos to Evanston. Sylvie Romanowski on 2017-09-27 14:27:55 -0500 commented: Very good Pelayo Enerio on 2017-09-27 11:57:40 -0500 commented: Spoke with Ms. Sylvie Romanoski to inform her that steel plates will be removed after restoration in few days. Sylvie Romanowski on 2017-09-21 23:50:41 -0500 commented: There are also metal plaques in the street in front of 929 and 1005 Madison. They were put in by RCN when they laid cable. miscategorized 3242360 I work for Schermerhorn & Co. and manage this condo building at the northwest corner of Michigan and South Blvd. The sidewalk we would like evaluated runs along the south side of the building on South Blvd. My direct line at the office is 847-420-9553 and my name is Mike Wolter. 520 Michigan Ave, Evanston, IL 60202, USA Henry Daniels on 2017-10-02 08:23:23 -0500 commented: Informational letter sent to email address. Edgar Cano on 2017-09-29 11:35:26 -0500 commented: This location has been mitigated. Called the number provided but was told it was a wrong number. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3247738 Caller says sidewalk has pitch that is making water collect and cause a hazard. Not sure if sidewalks are city or private property. Will attach photos of sidewalks and the issue. 990 Grove Street, Evanston, IL, United States Edgar Cano on 2017-09-29 10:59:12 -0500 commented: Multiple service requests have been submitted for this issue and they have all been merged into the following ticket number #2522083 to avoid duplication and improve service delivery. You will continue to be notified of the status of this work through the new ticket number #2522083. Private Property 3310454 Caller advised that he has approx. seven sidewalk squares in need of replacement. Caller is inquiring/ requesting to participate in the sidewalk replacement program and is requesting more information. 634 Judson Avenue, Evanston, IL, United States Henry Daniels on 2017-10-16 07:06:35 -0500 commented: An information/instruction letter has been sent to the attached email. Edgar Cano on 2017-10-13 14:49:08 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3316032 Resident recently paid for sidewalk repairs under the 50/50 shared cost and would like to know when will work begin. 1028 Cleveland Street, Evanston, IL, United States Henry Daniels on 2017-10-16 11:19:55 -0500 commented: Joshua, Thank you for your participation and payment in the 50/50 Program. The 2nd round locations list has been given to the contractor and the will be proposing a schedule for approval. I estimate that construction will begin in two to thee weeks. A letter giving specifics will be sent to all participants when a date is agreed upon. 50/50 Program 3394660 Resident is requesting a sidewalk evaluation and would like to be added to the 50/50 sidewalk replacement program for Spring 2018. 700 Michigan Avenue, Evanston, IL, United States Henry Daniels on 2017-11-08 07:29:42 -0600 commented: Program information has been sent to email provided. Edgar Cano on 2017-11-03 12:15:43 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3409403 Caller is reporting that there are approximately two sidewalk slabs adjacent to his property in need of replacement. Caller is requesting more information on participating in the 50/50 Sidewalk Replacement Program. 2621 Central Park Avenue, Evanston, IL, United States Henry Daniels on 2017-11-08 08:05:13 -0600 commented: Program information sent to email Edgar Cano on 2017-11-07 13:25:09 -0600 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3410712 Caller is interested in 50/50 program. 1402 Greenleaf Street, Evanston, IL, United States Henry Daniels on 2017-11-08 07:42:30 -0600 commented: Program information sent to email address. Edgar Cano on 2017-11-08 06:45:49 -0600 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3418780 Caller is reporting that there are multiple sidewalk squares in need of replacement adjacent to 1524 Simpson on both the Ashland & Simpson sides. Caller is requesting an evaluation and information regarding having the sidewalk squares replaced. 1524 Simpson Street, Evanston, IL, United States Edgar Cano on 2017-11-13 14:53:29 -0600 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3446355 Caller would like information about the 50/50 program and sign up. 3206 Thayer Street, Evanston, IL, United States Henry Daniels on 2017-11-17 07:33:14 -0600 commented: 50/50 Sidewalk Participation Letter was sent to provided email. 2018 program information will be sent in the spring. Thank you for using 311! Edgar Cano on 2017-11-16 13:45:26 -0600 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 364 of 549 Id Description Address Comments Type 3467563 C/W reports that she tripped on a "I found that the curb in that area was misaligned and I didn't see it because of the cover or leaves." Esther Williams-Hays 612 A South Blvd ewilliams@hays@gmail.com South Blvd and Ridge Edgar Cano on 2017-11-27 14:29:59 -0600 commented: Area of concern has been mitigated. Thank you for using the City of Evanston 311 Center. To view the status and details of your request, please follow the link to sign into your PublicStuff/311 account. Please note, you can also contact 311 directly during the hours of 7:00 a.m. to 7:00 p.m Monday - Friday by: Calling 3- 1-1 or 847-448-4311 (Outside of Evanston) Texting 847-448-4311 Emailing 311center@cityofevanston.org Edgar Cano on 2017-11-22 12:11:24 -0600 commented: Streets department set up a safety cone and barricade around area. Location has been scheduled for mitigation. Thank you for using the City of Evanston 311 Center. To view the status and details of your request, please follow the link to sign into your PublicStuff/311 account. Please note, you can also contact 311 directly during the hours of 7:00 a.m. to 7:00 p.m Monday - Friday by: Calling 3-1-1 or 847-448-4311 (Outside of Evanston) Texting 847-448-4311 Emailing 311center@cityofevanston.org Further details on the 311 Center are available 24/7 at www.cityofevanston.org/311 Sue Pontarelli on 2017-11-22 10:08:34 -0600 commented: Police sent to take Police Report. PWA notified to check the area. Issue Resolved 3495579 Caller reports the sidewalk is cracked in front of this address. He is interested in the 50/50 program. 2517 Colfax Street, Evanston, IL, United States Henry Daniels on 2017-12-05 08:15:43 -0600 commented: 50/50 Sidewalk Replacement Program Information has been sent address provided by email. You will be added to a list for Spring 2018 participation Thank you for using 311! Edgar Cano on 2017-12-01 14:51:32 -0600 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 365 of 549 Id Description Address Comments Type 2222425 Curb and sidewalk were damaged in front of cta Davis station by the bus waiting area. 1601–1659 Benson Ave,Evanston, IL 60201 John Jaminski on 2017-01-05 15:13:04 -0600 commented: Site has been secured and will repaired when temps are above freezing. Extending due date . John Jaminski on 2017-01-19 15:23:46 -0600 commented: Repaired thank you for using 311 Repair List 2230691 I would request that Rajeev Dahal (Public Works) and Paul D'Agostino (Environmental Services Bureau Chief) work together to create a cross-walk at 800 Elgin Road. 800 Elgin Road I would request we install an easy pedestrian cross-walk (mid-block). People are exiting daily / hourly the Optima Building (80O Elgin which has 250+ Units) are using this pathway daily (see footprints in snow picture for example). I estimated *50- people* a day are using this "unofficial" organic, pedestrian jaywalking pathway especially students walking to Northwestern during the school year (and when its not a blizzard outside). Both the large median street divider (in between the two opposite sides of Elgin Street) as well as the greenways area where the parkway meets the street (on the North side of Elgin)---could be easily enhanced and made safer. There are two areas that need "pavers," bricks, or simply some cement: 1) Between bushes (see pictures). 2) Between the two sides of the street. In short, we need a crosswalk installed before one of the 50+ people per day is hurt. Attached are several pictures which shows the general context/location and area on 794–898 University Pl,Evanston, IL 60201 Rajeev Dahal on 2017-01-20 10:44:26 -0600 commented: Dear Mr. Miller: We have reviewed your request for a crosswalk at 800 Elgin. Marked pedestrian crosswalks require ADA accessible ramps at the crossing. This would require reconstructing the sidewalks on either side of Elgin to create ramps and remove a portion of the raised median for access by people with disability including those on wheelchair. Metered parking space(s) and/or the parking pull off area would also need to be removed since parking is not allowed a minimum of 20 feet at marked crossings; our standard is 40 feet to 50 feet of no parking at mid-blocks for better visibility of pedestrians. This a short block with traffic signal controlled intersections at Benson to the west and Sherman to the east and it is safer for pedestrian to cross at these locations. Therefore, we will not recommending installing a midblock crossing at this location. Regards Rajeev Dahal Senior Project Manager Public Works Request Denied 2245299 327 Dempster going West on the north side of the street there is a low spot of sidewalk that floods because of the weather (3 squares of sidewalk). 327 Dempster St, Evanston, IL, United States John Jaminski on 2017-01-13 14:42:57 -0600 commented: please add to 50/50 Jennifer Levi on 2017-01-23 12:56:41 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program Attachment 2 366 of 549 Id Description Address Comments Type 2253173 Caller states that there is a utility box on the parkway that collects water and causes the sidewalk to flood. He says half measures have been taken, but the sidewalk has sunk and there's ice on the sidewalk when it's cold. There's also a water depth of 2 inches on the sidewalk by the fire hydrant. Mr. Buckley is requesting a phone call to discuss this. 231 Dempster St, Evanston, IL, United States Esmeralda Escobedo (311) on 2017-01-14 15:41:10 -0600 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed New Year’s January 2, 2017. City offices will re-open on Tuesday January 3, 2016. 311 is available on line 24/7 www.cityofevanston.org or you can contact 311 at: 847-448-4311 or 3-1-1 311 Hours – • Saturday December 31, 2016 9:00am – 3:00pm • Sunday – Closed • Monday January 2, 2016 9:00am – 4:00pm. Jennifer Levi on 2017-01-29 20:45:23 -0600 commented: I have alerted Paulina Albazi to advise. She is on vacation and will be back on 1/30/17 Yvette Hopson(311) on 2017-02-07 09:37:12 -0600 commented: Please review this request, it is overdue. Thanks, Yvette Henry Daniels on 2017-02-27 12:45:12 -0600 commented: Called provided phone number but doesn't seem to be functional, message plays but no beep/tone to leave a message. Henry Daniels on 2017-02-27 12:43:24 -0600 commented: The recessed vault lid in the parkway is adjacent to the walkway and does not affect pedestrian travel. Cannot reach for follow-up 2254918 Brick colonial at intersection of Lincoln and Ashland Ave. Sidewalk on Lincoln is subject to freeze and thaw due to low grade, CONSTANTLY treacherous ice. 1600 Lincoln St, Evanston, IL 60201, USA John Jaminski on 2017-01-19 15:18:37 -0600 commented: Due to high volume of 311's/work load I'm extending the due date. Jennifer Levi on 2017-01-29 20:33:29 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2255464 Caller states that the sidewalk in front of 1933 Darrow is low and always accumulates water that turns into ice in the winter, the caller is requesting for the sidewalk to be leveled so that every year they do not go through that issue. 1933 Darrow Ave, Evanston, IL, United States Jennifer Levi on 2017-01-23 13:29:44 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2256247 All of the sidewalks on the 1900 block of dodge (east side) from foster to Emerson are terrible. They are lopsided and cracked. Right now all of the sidewalks are flooded because of their terrible condition and they pose a tripping hazard. Please review. 1925 Dodge Ave,Evanston, IL 60201 John Jaminski on 2017-01-23 15:16:53 -0600 commented: sidewalk remediated. Jennifer Levi on 2017-01-29 21:30:49 -0600 commented: Thank you for contacting 311! 50/50 Sidewalk Replacement Brochures will be sent to the addresses provided as soon as an evaluation has been done . Addresses will then be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 367 of 549 Id Description Address Comments Type 2258924 Caller states that the way the sidewalk is leveled causes puddles of water or ice on the sidewalk and people have to walk on the muddy parkway. 1433 Hinman Avenue, Evanston, IL, United States Jennifer Levi on 2017-01-23 13:02:15 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2258988 The sidewalk on the East side of the street has huge puddles of water, it seems that when it rains the water does not drain; there is standing water. The caller is requesting the sidewalk to be leveled correctly 1500 Maple Avenue, Evanston, IL, United States John Jaminski on 2017-01-17 14:51:40 -0600 commented: The pothole has been filled. Thank you for using 311. Issue Resolved 2263060 The caller states that there is about 3 or 4 squares long there is a huge puddle and the sidewalk needs to be leveled correctly. Richard Shapiro: "Puddle #2 is ~50 or 60 feet south of puddle #1. It's about a third or a quarter of the size of paddle #1 and I didn't mention puddle #2 when I called because I wasn't aware of it until I after I hung up. The puddles are both in front of 1319 Chicago Avenue, separated by about 50 or 60 feet." 1319 Chicago Avenue, Evanston, IL, United States John Jaminski on 2017-01-19 15:21:09 -0600 commented: Due to high volume of 311's/work load I'm extending the due date. John Jaminski on 2017-01-23 15:08:32 -0600 commented: When the ground is frozen the water can't drain. will pass to the 50/50 program Jennifer Levi on 2017-01-29 20:09:31 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2267886 Sidewalk on the west side of the property is cracked and also water accumulated when it rains making it dangerous for pedestrians when it freezes. 833 Reba Place, Evanston, IL, United States John Jaminski on 2017-01-23 15:04:14 -0600 commented: cracked patched. Yvette Hopson(311) on 2017-01-26 13:39:00 -0600 commented: Please review this request, it is overdue. Thanks, Yvette John Jaminski on 2017-01-26 15:02:31 -0600 commented: please add to 50/50 Jennifer Levi on 2017-01-27 13:33:02 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 368 of 549 Id Description Address Comments Type 2292025 Caller states that prior to the renovation to the sidewalk in front of Chicken Shack, there was a curb, but after the renovation, the curb cut was smaller. Resident is in a wheelchair and he would like to know why this was done. 1925 Ridge Ave, Evanston, IL 60201, USA Sat Nagar on 2017-07-14 09:43:19 -0500 commented: Without the State budget the project was shutdown two weeks ago. The contractor is expected to submit a schedule next week and this work will done this month. Thanks for your patience. Sat Nagar on 2017-06-20 16:45:02 -0500 commented: The contractor is scheduled to complete this work next week. Sat Nagar on 2017-06-09 11:20:55 -0500 commented: We have coordinated the work with the contractor and is expected be done any time. Yvette Hopson(311) on 2017-06-09 10:11:01 -0500 commented: Larry called today to follow up on service request. Provided Larry with the details from the above comments. Also transferred Larry to Sat's extension for additional follow up. Sat Nagar on 2017-04-24 08:35:52 -0500 commented: Hi Larry - we have reviewed the width of sidewalk and the width has not changed. The sidewalk is five feet wide and meets the ADA Standards. If you have any question, please call me at 847-866-2967. Sat Nagar on 2017-01-30 16:07:47 -0600 commented: Caller states that prior to the renovation to the sidewalk in front of Chicken Shack, there was a curb, but after the renovation, the curb cut was smaller. Resident is in a wheelchair and he would like to know why this was done. Sat Nagar on 2017-02-07 10:14:53 -0600 commented: Hi Larry; The contractor is not working during winter months and we will review the curb cut and make necessary changes in late March this year. Sat Nagar on 2017-03-29 11:31:32 -0500 commented: We will bestarting E/R/GB work soon and we will address your concern. Issue Resolved 2301091 Caller is reporting that at the corner of Maple & Grove there is a brick paved area that has multiple uneven bricks. Caller advised that this is a trip hazard and is requesting that the sidewalk area be repaired. Maple & Grove Evanston John Jaminski on 2017-01-30 06:53:44 -0600 commented: Sidewalk will be repaired when temperature increases bricks and ground frozen . Extending due date. Thank you for using 311. John Jaminski on 2017-02-20 14:52:12 -0600 commented: sidewalk has been repaired. thank you for using 311. Sidewalk on repair list 2323009 caller states that the sidewalk is pushed up from the tree roots and it has become a trip hazard. caller states that his wife fell and is in the hospital because of the fall. 1640 Maple Ave, Evanston, IL 60201, USA John Jaminski on 2017-02-08 15:09:27 -0600 commented: broken paver repaired in front of this address. Any addition work will be done in the spring. Sidewalk on repair list 369 of 549 Id Description Address Comments Type 2326387 The sidewalk and parkway on the 1400 block of Wesley was not constructed well. So when it rains, the water pools up on the sidewalk rather than drain into the street. I have reported this issue before because my neighbor is elderly,lives alone, and cannot walk in front of her house with her walker. So far this department considered the issue resolved because they were going to send me a brochure about a 50-50 plan to repair the sidewalk. Why should homeowners pay for poor work? Can someone at least look at the street and offer an opinion? I have video, but it appears you don't accept that. 1410 Wesley Ave, Evanston, IL 60201, USA Thomas Tharayil on 2017-02-07 08:04:28 -0600 commented: The sidewalk from Greenwood and Wesley facing North Thomas Tharayil on 2017-02-07 08:06:06 -0600 commented: 1410 Wesley facing South Thomas Tharayil on 2017-02-07 08:02:49 -0600 commented: The parkway- instead of the sidewalk tilting towards the street it backs up into the parkway Yvette Hopson(311) on 2017-02-13 12:43:18 -0600 commented: Please review this request, it is overdue. Thanks, Yvette James Maiworm on 2017-02-13 14:58:03 -0600 commented: Good Afternoon, The sidewalk at this location seems to be in good condition and is not a candidate for replacement. The water ponding problem seems to be because the parkway grade is higher than the sidewalk which does not allow for the water to flow into the grass. Although no work can be done now as it is February, come spring Public Works will lower the parkway grade in spots and re-sod. this will allow for surface drainage and should improve the condition. We expect this work to be completed by mid May. Have a great rest of the week. Sidewalk on repair list 2326508 Part of the sidewalk has partially caved in approximately 2-3" at 2111 Emerson; caller has seen people trip. 2111 Emerson St, Evanston, IL 60201, USA John Jaminski on 2017-02-08 15:03:19 -0600 commented: re-mediated Jennifer Levi on 2017-02-10 11:00:00 -0600 commented: 50/50 Sidewalk Replacement Brochure will be sent to the address provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2328912 Caller stating that the sidewalk in front of his home is coming up and could be a trip hazard. 1313 Cleveland John Jaminski on 2017-02-08 15:05:31 -0600 commented: Re-mediated Jennifer Levi on 2017-02-16 11:14:15 -0600 commented: Thank you for contacting 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 370 of 549 Id Description Address Comments Type 2331754 Caller states that the sidewalk is broken up and there are puddles of water everywhere. 1336 Chicago Ave, Evanston, IL 60201, USA Paulina Albazi on 2017-02-14 15:50:09 -0600 commented: completion date extended to allow staff time to respond. Yvette Hopson(311) on 2017-02-14 14:48:55 -0600 commented: Please review this request, it is overdue. Thanks, Yvette Jennifer Levi on 2017-02-15 14:03:19 -0600 commented: Thank you for Contact 311! A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2338349 Sidewalk caving in by 917 Grove on the North side of the street. 917 Grove St, Evanston, IL 60201, USA John Jaminski on 2017-02-13 15:10:12 -0600 commented: Brick sidewalks will be repaired in spring when the bricks and ground are not frozen. John Jaminski on 2017-02-20 14:53:27 -0600 commented: Sidewalk has been repaired. thank you for using 311. Sidewalk on repair list 2343140 Caller states sidewalk is missing asphalt and has holes in misc. places. Caller described the area as a trip hazard. Location on west side of street from Sherman to Gaffield and Sherman and Noyes Sherman and Gaffied Daniel Kwiecinski on 2017-02-14 14:57:53 -0600 commented: remediated Jennifer Levi on 2017-02-15 13:50:31 -0600 commented: A 50/50 Sidewalk Replacement Brochure will be sent to the address provided. Address will also be added to the 50/50 Sidewalk Replacement Project. 50/50 Program 2345271 Caller is reporting that on the North East corner of Church & Orrington there are two bricks missing from the sidewalk. Caller is requesting that the bricks be replaced. Church & Orrington Evanston John Jaminski on 2017-02-14 11:41:04 -0600 commented: The bricks have been replaced. Thank you for using 311. Issue Resolved 2352414 Caller reports that the building located just south of 1322 Chicago Avenue has a sidewalk slab in disrepair. Chicago Avenue & Dempster Street, Evanston, IL John Jaminski on 2017-02-17 11:59:34 -0600 commented: Thank you for the report. Site was inspected and found not to be in a state of disrepair. Will continue to monitor site. Thank you for using 311. Request Denied 2365917 Caller states on the East side of Sherman the sidewalks are filthy on the north side of church. Caller wants something done as soon as possible as it has been this way for a long time. Sherman and Church Kevin Johnson on 2017-02-21 13:10:37 -0600 commented: We have received your 311 request and will address your concerns as soon as possible. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Vonnie Moore on 2017-02-24 14:13:00 -0600 commented: This request due date will be extended due to the high volume of 311 requests. We will address your concerns as soon as possible. Thank you for using the 311 system. Vonnie Moore on 2017-02-27 14:44:14 -0600 commented: Upon inspection today by city crews, nothing was found on the sidewalk. Thank you for using the 311 system. Request Denied 371 of 549 Id Description Address Comments Type 2397741 Sidewalk is sinking and fills with water and ice during winter. Location is next to 1825 Crain to the west. There is not a property at this location. Caller reports a tree was removed some time ago, causing the sidewalk area to sink. 1827 Crain St, Evanston, IL 60202, USA Beverly Otey (311) on 2017-03-03 09:31:37 -0600 commented: From the map, it appears this is on Crain, near Dodge. Jennifer Levi on 2017-03-07 12:52:57 -0600 commented: Hello, we will have to contact the owner of the lot, due to the fact that no building at the location mentioned. Thank you. Gay Riseborough on 2017-03-07 11:24:49 -0600 commented: And who is the "property owner" who will receive the 50/50 information ? There is no building at that address. Jennifer Levi on 2017-03-08 10:59:36 -0600 commented: Hi John, can you have the area inspected. Jennifer Levi on 2017-03-07 11:18:29 -0600 commented: A 50/50 Sidewalk Replacement Brochure will be sent to the address provided by the property owner. This address will also be added to the 50/50 Sidewalk Replacement Project. Thank you for contacting 311! Gay Riseborough on 2017-03-07 18:16:30 -0600 commented: Well, the property owner is the Crain St. Commons Condominium Association, of which I am Secretary -- resigning however. Please address notice to Glen Malyon, President, 12 11 Dodge, Evanston 60202. Isn't there another way this can be handled besides complete replacement? Do you ever do concrete "lifting", where they inject concrete underneath, through a hole they bore in the sidewalk? Jennifer Levi on 2017-03-08 10:55:18 -0600 commented: Thank you for the additional information. I will forward this to the department coordinator to have the property site evaluated. We will then reach out to Glen Malyon about the program. Thank you again for contacting 311. 50/50 Program 372 of 549 Id Description Address Comments Type 2423268 My husband was walking home from Osco, carrying a backpack full of groceries, some in glass jars. He tripped on a gap in the sidewalk that Google describes as 561 Hamilton street ( the address on the house is not clearly apparent.) The house is on the south side of Hamilton street, and has a green door (photo attached.) He fell, and though some of the glass enclosed items broke, he wasn't injured. An old man with a cane was walking behind him, and We would hate to think it could have been him that might fall. This was in broad daylight and my husband is quite able bodied. Evanston is extremely dark at night and much of the sidewalk in front of this house is compromised, and therefore dangerous. I am sending a photo of the side walk I am speaking of. There's a lot of foot traffic here because of the proximity to grocery stores and businesses. I suggest that this sidewalk area should be a top priority for repair. Perhaps it could be marked with neon spray paint in the mean time. If you need to call, my my phone number is: 612-325-9451. Thank you for addressing our concern. Kimberle Linder 524 Hamilton St, Evanston, IL 60202, USA John Jaminski on 2017-03-21 15:02:21 -0500 commented: sidewalk has been mitigated. thank you for using 311. Issue Resolved 2435638 Just tripped over an uneven paving slab, and don't want anyone to seriously injure themselves by doing the same thing. Please fix this you wonderful lot. 533 Dodge Ave,Evanston, IL 60202 John Jaminski on 2017-03-17 06:36:22 -0500 commented: sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2449101 Caller states that the sidewalk on the south side of the street in front of this address needs repair. 830 Davis Street, Evanston, IL, United States Edgar Cano on 2017-03-27 14:16:09 -0500 commented: Sidewalk concerns at this location have been mitigated. Thank you for using 311. Issue Resolved 2462246 my son tripped and fell on this sidewalk crack. 501-517 Kedzie Street, Evanston, IL 60202, USA Edgar Cano on 2017-03-24 15:25:49 -0500 commented: Thank you for bringing this to our attention. I will forward this information to our 50/50 sidewalk program. Thank you for using 311. Jennifer Levi on 2017-04-13 13:48:13 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 373 of 549 Id Description Address Comments Type 2466693 There is no sidewalk ramp at any of the corners at this intersection. This makes it very difficult for anyone using a wheelchair to navigate this area without using driveways and traveling in the street. Can this be fixed? 1799 Oak Ave, Evanston, IL 60201, USA Rajeev Dahal on 2017-03-27 09:03:28 -0500 commented: We will review the location. Rajeev Dahal on 2017-04-04 11:09:47 -0500 commented: Dear Ms. Shechtman We have reviewed the location. The City is waiting to receive sidewalk improvement design plans at this intersection from the developer for the approved 1815 Oak/Ridge development. The concrete median necessitates that the sidewalk on the north side to be redesigned and constructed for proper access. In the meantime, those on wheelchairs could use the crosswalk on Oak (to the south) which has ADA ramps, signs and markings. Best Regards Rajeev Dahal Senior Project Manager Capital Planning & Engineering Sidewalk on repair list 2471587 Caller is inquiring about having the curb(not sidewalk) adjacent to this property replaced. Caller is requesting information on this process. 318 Asbury Avenue, Evanston, IL, United States Edgar Cano on 2017-03-27 15:24:02 -0500 commented: Thank you for using 311. We will have our Capital Planning Bureau contact you with information regarding this matter. Edgar Cano on 2017-04-06 15:09:36 -0500 commented: This area was added to our list for mitigation inspection. Completion date has been pushed back due to weather. Thank you for using 311. Edgar Cano on 2017-04-07 15:02:09 -0500 commented: Curb has been mitigated. Thank you for using 311. Sidewalk on repair list 2479290 The property is currently vacant land, and the sidewalk in front of the property is covered in 1-3 inches of mud, making it difficult to walk through. Additionally, the ground where one would walk to avoid the sidewalk is also mud, so it is very difficult for one to use the sidewalk. (Aka, the whole area is mud that one cannot walk around and it needs to be maintained) It also was not properly maintained during the winter (snow removal/salting). Thanks! 1925 Grant St, Evanston, IL 60201, USA Edgar Cano on 2017-03-31 10:54:12 -0500 commented: The sidewalk has been mitigated. Thank you for your comments and for using 311. Have a wonderful day. Issue Resolved 2486767 Sidewalk on South side, about 1010 Austin. (picture attached) 1010 Austin Street, Evanston, IL, United States Edgar Cano on 2017-03-31 15:09:31 -0500 commented: Sidewalk has been mitigated. Please let us know if you would like to participate in our 50/50 sidewalk program. Thank you for using 311. Issue Resolved 374 of 549 Id Description Address Comments Type 2492959 I’m certain that this bad area of sidewalk fronting the Bank of America at Chicago and Greenwood has been identified with you. (Picture Attached) I just wanted to add that I hope this unsafe situation gets dealt with as soon as possible. Please send me an e-mail confirmation of the report. Thanks, Ryan Chicago and Greenwood Edgar Cano on 2017-04-04 07:46:33 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Yvette Hopson(311) on 2017-04-11 12:09:55 -0500 commented: Additional information received from Michelle Laussen via email 4-11-17 at 1130hrs: Hello, My name is Michelle. I live at 1326 Chicago Ave, next to the Bank of America. The sidewalk right in front of the B of A has sunken and constantly remains flooded after a rain. Basically it is impassible unless you go into the mud on either side of the concrete. Someone has taken it into their own hands and dropped tow cement slabs/rocks on the grass, but this hardly alleviates the issue. I am not even sure if I am contacting the right place to point out this issue. Please point me in the right direction if I am erroneous. Thank you :) Michelle Jennifer Levi on 2017-04-11 12:34:24 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to the current owner on April 5th 2017 by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! Sidewalk on repair list 2495310 The walkway/sidewalk in front of 234 Custer Ave is uneven and has created a slip/hazard for the foot traffic along the sidewalk. I purchased the home in 2016 and have been told from neighbors that the uneven surface is the result of work performed on drain lines running below the sidewalk in 2014 and 2015. I was curious if the city would pay for a portion (or all...) of the repair, as this is a health & safety hazard for pedestrians. This area has lots of foot traffic, and it currently accumulates mud/soil in the gap between the sidewalk and the residential walkway. 234 Custer Ave, Evanston, IL 60202, USA Edgar Cano on 2017-04-04 15:26:04 -0500 commented: Thank you for your comments. Upon evaluation it was noted that the walkway is on the homeowners property and belongs to the homeowner. The city does not repair/replace or pay for resident owned walkways. We could not find evidence that it was caused by city drain repair. Thank you for using 311. private property 375 of 549 Id Description Address Comments Type 2501671 Depending on the season, the sidewalk at 2316 Brown Ave. is either a lake or an ice rink. This is incredibly unsafe for commuters and kids walking to school. 2316 Brown Ave, Evanston, IL 60201, USA Edgar Cano on 2017-04-07 15:16:42 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Jennifer Levi on 2017-04-13 13:32:59 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by postal mail. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2506506 There is a drain on the parkway that the city installed to deal with flooding issue. Drain must be clogged or something. 2200–2298 Lincoln St,Evanston, IL 60201 Robert Bauer on 2017-04-07 06:52:15 -0500 commented: Spoke with resident and discussed flooding issue and drain engineering. 50/50 Program 2510314 The sidewalk in front of the building (near the playground) is crumbling and is difficult to walk on. 2010 Dewey Ave, Evanston, IL 60201, USA Edgar Cano on 2017-04-12 13:36:53 -0500 commented: The area has been assessed and scheduled for repair. Thank you for using 311. Sidewalk on repair list 2522083 City installed brick pavers and the ones abuting the threshold of the building are sinking causing an area that pools with water when it rains and now a trip hazard. Water is now being directed toward the building and under the slate entrance. 990 Grove St, Evanston, IL 60201, USA Edgar Cano on 2017-10-04 07:50:19 -0500 commented: Property lines are not determined by where sidewalks begin or end but by parcel boundary lines. Walkways (or sections of), in front of a building, may not fall within City ROW limits and may be within private boundary lines. The same way that neighboring parcels of land can have a single walkway adjacent to both properties yet "ownership" of sections divided and separated by boundary lines; such as the case of two neighboring homes. If property management believes COE has made an error, they may bring their plat of survey or maintenance agreement to COE offices to be reviewed.Thank you for using 311. on 2017-10-03 17:43:50 -0500 commented: I have been to the site recently, and I believe the pavers are in fact city property. There is only one sidewalk in that area, and it is the one at issue. Please let me know how it is possible that a sidewalk is considered private property. I am new to this so I really do not know how that could happen. Thanks Edgar Cano on 2017-04-14 10:37:10 -0500 commented: Thank you for your comments. Upon review, it was noted that the pavers appear to be on private property and not within the City right of way. Responsibility would fall under the property owner. Thank you for using 311. private property 2524394 1330 Chicago Ave,Evanston, IL 60201 Edgar Cano on 2017-04-12 13:17:36 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Sally Wood on 2017-04-14 03:03:34 -0500 commented: Thank you for the excellent service Edgar! Issue Resolved 376 of 549 Id Description Address Comments Type 2529270 Caller reports the brink tiles of the sidewalk have started to sink making the sidewalk uneven and a trip hazard. 714 Main Street, Evanston, IL, United States Edgar Cano on 2017-04-14 10:46:29 -0500 commented: Thank you for your concerns. At this time, it appears that natural occurring settling is taking place. We will continue to monitor location for precarious conditions. Thank you for using 311. Issue Resolved 2533265 Caller reports that the sidewalk slab, specialty pavers are damaged on Chicago Avenue, at the northeast corner of Chicago and Main. Chicago Avenue & Main Street Edgar Cano on 2017-04-18 11:51:33 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2541615 This is not a complaint about the sidewalk (as the title states...your 311 system would not allow me to enter Alley - Maintenance), but one about the alley behind 1640 Maple Avenue. The speed bump strips (2 of them) that were installed in the alley are missing and need to be replaced. Can you please reinstall them or better yet, install permanent speed bumps in the alley as this is an annual issue? I do not see our location included in any of the zones on the schedule for alley maintenance on the recent 2017 Alley Maintenance Schedule. Thank you. 1640 Maple Ave, Evanston, IL 60201, USA Patricia Corirossi on 2017-04-18 23:38:29 -0500 commented: With the alley being used heavily for deliveries to the businesses along Davis and now also servicing the Smylie Brothers and The Barn restaurants, it has become a very busy passthrough area for cars. I was almost hit recently when a car came flying east in the alley and didn't bother to stop or look for pedestrians when turning onto Maple. Please take this into consideration for the permanent speed bumps requested. Edgar Cano on 2017-04-18 15:09:16 -0500 commented: Thank you for your comments. At this time, we are no longer installing the bolt down speed bump strips. Your location will be put on a list to be further evaluated for possible "permanent" speed bump installation. Thank you for using 311. Miscategorized 2546509 Resident stated that in front of the dialysis center there is a bump on the sidewalk that is a trip hazard, he is requesting the sidewalk to be fixed; caller did states that he tripped over that sidewalk. 2953 Central Street, Evanston, IL, United States Edgar Cano on 2017-04-19 14:55:27 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2551798 Reported to 311 via E-mail. "Missing sidewalk paving causing a tripping hazard, where sidewalk meets the entrance ramp to the underground library parking lot (see attached photo)." Requesting repair. 1701 Orrington Avenue, Evanston, IL, United States Edgar Cano on 2017-04-25 15:29:02 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2562232 no 1802-1804 Hartrey Ave, Evanston, IL 60201, USA Henry Daniels on 2017-04-26 07:55:57 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 15:34:39 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 377 of 549 Id Description Address Comments Type 2563538 The sidewalk south of 913 Wesley on east side of street has several areas where the slabs have settled. One is south of 913 Wesley driveway and a large puddle is created whenever there is heavy rainfall or when snow melts in winter. The problem in winter is also that ice forms in this area. It is due to roots that died when trees were replaced. same problem occurs further south where newer trees replaced the older elms or even a newer maple. This sidewalk is also alongside 1325 Main Street, that we also own together with 913 Wesley I can be reached at 847-866-7760 (work) or 847-866-9519 (home) Thank you Elliott Dudnik 913 Wesley Ave, Evanston, IL 60202, USA Henry Daniels on 2017-04-26 07:50:58 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-25 06:45:14 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2568586 Submitting a request for the City of Evanston 50/50 sidewalk repair program. Please contact me with the next steps. 721 Wesley Ave, Evanston, IL 60202, USA Henry Daniels on 2017-04-26 07:42:50 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 06:44:13 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2568855 We would like to participate in the 50/50 sidewalk program for the section of sidewalk running north-south in front of our house. Thanks. 1431 Judson Ave, Evanston, IL 60201, USA Henry Daniels on 2017-04-26 07:41:14 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by Email, postal mail and attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-26 06:44:56 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 378 of 549 Id Description Address Comments Type 2569900 There are 4 squares that were replaced within the past 2-3 years, during a work project. There are 2 squares on the north side of the curb and 2 on the south side of the curb. All have started sinking on one side which results in water accumulating on the walk. Can the city look into repairing this? 632 Dodge Avenue, Evanston, IL, United States Henry Daniels on 2017-04-28 15:26:54 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-04-28 14:32:30 -0500 commented: Thank you for your comments. Our records do not show our Streets Department replacing that area of carriage walk. It would be up to the homeowner to repair. The city could do the repairs through the 50/50 program but the full cost would be paid by the homeowner. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2606789 Hello, we manage the building at this address. We were getting complaints, so we went to the building, and the public sidewalk at 614- 18 Elmwood is seriously caving in causing massive puddles and trip hazards. 614 Elmwood Ave, Evanston, IL 60202, USA Henry Daniels on 2017-05-05 15:50:48 -0500 commented: A 50/50 Sidewalk Participation Letter was sent address provided by email attached to this comment. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-05 14:54:45 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2610513 Several of our front sidewalk slabs are in need of repair. Honestly, it might be all but one of them. Quite large cracks and one in full buckle. I wanted to see if they would qualify for the 50/50 program. Thank you. Jamie Uppenberg, 773-988-0477 1012 Harvard Terrace, Evanston, IL 60202, USA Henry Daniels on 2017-05-08 16:44:32 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-08 06:46:29 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2617898 On the Ashland side of the street there is a spot were the sidewalk is cracked and mighty be a trip hazard, the caller is requesting patching. 1531 Lincoln Street, Evanston, IL, United States Henry Daniels on 2017-05-11 07:29:30 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-10 15:09:42 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2623679 On the east side of Ashland to the corner where ashland meets Emerson the sidewalk is so cracked from 1843 Ashland to the corner. The sidewalk is so uneven I can't even stroll my stroller to the corner. I have to walk on the grass. Please fix! 1843 Ashland Ave,Evanston, IL 60201 Edgar Cano on 2017-05-17 15:29:08 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Henry Daniels on 2017-05-15 07:32:15 -0500 commented: Sent information to management company 5/12/17 Issue Resolved 379 of 549 Id Description Address Comments Type 2631706 We fixed the grates around the trees at bar louie and found that the brick pavers around some of the trees are missing or lifted. Can streets please fix the bricks? Thank you, Matt 1520 Sherman Avenue, Evanston, IL, United States Edgar Cano on 2017-05-17 10:32:51 -0500 commented: Matt- It seems the reason they appear lifted is to meet the elevation of the tree grates. If possible the tree grates need to be lowered or removed. Please call me to discuss this matter. Thank you. Tree grate issue that impacts sidewalk 2636085 I was traveling and just realized the deadline for the city sidewalk repair request was the 12th. I thought it was Monday the 15th. Any chance you could take a look at our sidewalks? Several of them are in need of replacement. 650 Michigan Ave, Evanston, IL 60202, USA Henry Daniels on 2017-05-17 10:11:55 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-05-15 06:56:46 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2636960 Reported via Twitter/ Tweet to 311. "This whole block at Mulford and Callan need sidewalk repair." No further information provided. Please see attached photo. Mulford & Callan Evanston Edgar Cano on 2017-05-18 08:20:32 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2638263 Caller is reporting that on 5/5/2017 his wife tripped on uneven sidewalk and was injured/ broke a bone(humerus). Caller is reporting that the uneven sidewalk is on the South West corner of Central & Green Bay near where an electrical panel is accessed. Caller is reporting this so that the uneven ground can be addressed to prevent further injury. Central & Green Bay Evanston Edgar Cano on 2017-05-15 12:42:03 -0500 commented: The location has been mitigated. Thank you for using 311. Christopher Polinski(311) on 2017-05-15 10:29:28 -0500 commented: SDO-311 transferred Caller to the Legal Services Division in regards to Filing a Claim upon request. Issue Resolved 2669514 Caller reports as walking south on Hinman near The Homestead, the sidewalk is cracked and broken and she knows that people have fallen and been injured. 1625 Hinman Avenue, Evanston, IL, United States Edgar Cano on 2017-05-24 14:33:23 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2670833 Various sidewalk blocks are buckling in the 1900 block (even) of dodge. Can cause tripping. 1922 Dodge Ave,Evanston, IL 60201 Edgar Cano on 2017-05-23 15:06:50 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 380 of 549 Id Description Address Comments Type 2671431 White paint spilled on sidewalk. Caller would like it power washed. Sidewalk is across from listed address. 2537 Hastings Ave, Evanston, IL, United States Kevin Johnson on 2017-05-30 15:52:03 -0500 commented: The paint has been removed. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Kevin Johnson on 2017-05-26 06:35:08 -0500 commented: This request due date will be extended due to the high volume of 311 requests. We will address your concerns as soon as possible. Thank you for using the 311 system. Kevin Johnson on 2017-05-23 11:40:39 -0500 commented: We have received your 311 request and will address your concerns as soon as possible. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Issue Resolved 2671550 Sidewalk cracked and needs repaired. There are two orange "x's" on the sidewalk that caller believes were placed there by the city. The caller is not interested in the 50/50 program. 2115 Greenwood Street, Evanston, IL, United States Edgar Cano on 2017-05-24 14:28:36 -0500 commented: Sidewalk has been mitigated. The orange marks do not appear to be city markings and no record of the address could be found for the 50/50 Program. Thank you for using 311. Issue Resolved 2685415 Do you have any estimate when the sidewalks might be finished? I live at 522 Church, always use either a cane or walker. The conditions here are very difficult to deal with, and an estimate would be very helpful. Thank you. Rita Mendelsohn 522 Church Street, Evanston, IL, United States Sat Nagar on 2017-05-30 15:24:22 -0500 commented: Sidewalk and street resurfacing will be complete by June 9, but we will make sure either north or south portion of the Chicago Avenue at Church Street is open to pedestrians at all times. Angel Delgado (311) on 2017-05-26 10:50:12 -0500 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed for the Memorial Day Holiday 5/29/2017. City offices will re-open on Tuesday 5/30/2017 311 is available on line 24/7 www.cityofevanston.org or please contact us at 311 or 847-448-4311 Saturday 5/27/17 9:00am – 5:00pm Tuesday 5/30/17 7:00am – 7:00pm Edgar Cano on 2017-05-26 06:51:48 -0500 commented: Streets Department will conduct another mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program timeframe. Thank you for using 311. Issue Resolved 381 of 549 Id Description Address Comments Type 2691452 Hi Tom, We are resident in your ward. We live at 3422 Park Place just west of Gross Point. I am contacting you about a concern I raised with Tendam before he left that still has not been resolved. There is a construction horse and concrete parking caps that have been obstructing the sidewalk on Crawford and Central for over a year. We have young kids and literally cannot use this sidewalk when pushing our stroller due to the obstruction. It's also dangerous because families either have to walk into the CVS parking lot or the street to get around it. I know a lot of work is being done on the sidewalks in our neighborhood so maybe they will fix this as part of that project but I want to make sure because it is dangerous and needs to be fixed. Please let me know when this can be resolved. Thank you. 3333 Central St,Evanston, IL 60201 Tom Suffredin on 2017-05-31 10:47:47 -0500 commented: Very good Edgar Cano on 2017-05-30 15:06:37 -0500 commented: Thank you for your comments and for bringing this to our attention. The Streets Department has removed the wheel stops from the sidewalk. The barricade can not be removed at this time, since it is being used to cover a light pole base. Traffic Operations Department is aware of the missing light pole and working on repairs. The barricade will be removed once repairs are complete. Thank you for using 311. Issue Resolved 2695216 Caller to Evanston 311 voicemail reporting the north/west corner sidewalk is flooded. It is half of the sidewalk that is impassable. Caller says this is a reoccurring issue and would like for to be checked and fixed. Caller advised that a possible solution may be to regrade the lawn to allow the sidewalk to drain properly. Michigan and Greenleaf Edgar Cano on 2017-06-02 10:19:18 -0500 commented: The area has been mitigated. We will continue to monitor location. Thank you for using 311. Issue Resolved 2698013 Resident is reporting that this sidewalk is in disrepair. 1421 Maple Avenue, Evanston, IL, United States Edgar Cano on 2017-06-01 15:16:23 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2707906 On the north side of Reba Place between 701 and 723 there are at least three trip hazards in the sidewalk, as well as drainage issues with the associated sidewalks. Ice hazards are common during the winter months and deep puddles during the spring, summer and fall. 723-727 Reba Pl, Evanston, IL 60202, USA Edgar Cano on 2017-06-02 14:51:21 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2712977 Large buckle in sidewalk east of address. Caller saw someone fall due to buckle. 323 Hamilton Street, Evanston, IL, United States Edgar Cano on 2017-06-02 15:04:35 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 382 of 549 Id Description Address Comments Type 2722105 2 sidewalk pads in front of callers home are trip hazards. Caller was advised that the city will be doing other sidewalk work and wanted to have the sidewalk checked at same time. 1104 South Boulevard, Evanston, IL, United States Henry Daniels on 2017-06-09 16:19:45 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-05 11:50:37 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2722713 Caller is reporting that on the South East corner of Hinman & Main there is uneven sidewalk that is a trip hazard. Caller is requesting that the sidewalk on this corner be evened out. Hinman & Main Evanston Edgar Cano on 2017-06-07 14:50:17 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2723825 Caller states the sidewalk in front of the restaurant is crumbled and dangerous for seniors. 2424 Dempster St, Evanston, IL, United States Susan Kessler on 2017-06-07 17:02:47 -0500 commented: Report is false. My 89 year old mother-in-law nearly fell due to the crumbling sidewalk that BELONGS TO THE CITY!!! Contact Kabul House owner and resolve this dangerous situation that Evanston is now aware of before someone gets hurt! Susan Kessler on 2017-06-07 17:00:48 -0500 commented: Very poor Edgar Cano on 2017-06-07 14:42:48 -0500 commented: Area was surveyed and no crumbling concrete was found on city walkways. Thank you for using 311. Issue Resolved 2731400 At 9:30 this evening I tripped and fell on a very uneven sidewalk -- 1 1/2-2 inch heave in sidewalk -- on the Northside of Dempster about 40 feet east of Ridge. This is also a spot with NO streetlight shining on sidewalk. I don't think I have any broken bones, but this should be repaired immediately. Flash photo is attached. 1133–1205 Dempster St,Evanston, IL 60201 Edgar Cano on 2017-06-07 14:47:20 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2737942 Caller reports the sidewalk near the alley has buckled because of the tree and causes a trip hazard. Caller reports there is about a 2 inch drop off. Caller stated the location is near the Ridgeville Park District, near the alley, across from 907 Seward. That appears to be 904 Seward. 904 Seward Street, Evanston, IL, United States Edgar Cano on 2017-06-08 14:32:17 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 383 of 549 Id Description Address Comments Type 2738906 Maintenance needed on curb along this side of street. The other side was completed a few years back but work crews never returned for the opposite side. 2405 Noyes Street, Evanston, IL, United States Bonnie Anthony on 2017-06-11 15:53:33 -0500 commented: NEW CURBS WERE PUT IN APPROX 4-5 YEARS AGO ON THE 2400 BLOCK OF NOYES ST BUT ONLY THE NORTH SIDE OF THE STREET WAS DONE. WAS TOLD THE SOUTH SIDE OF THE STREET WOULD BE DONE THE FOLLOWING YEAR!HAS NEVER HAPPENED. I HAVE CONTACTED THE CITY EACH SPRING AND NO NEW CURBS OR THE HANDICAP RAMP ON THE ALLY HAS BEEN DONE. HELP!!! HOMEOWNER AT 2405 NOYES ST--BONNIE ANTHONY Bonnie Anthony on 2017-06-11 15:49:11 -0500 commented: Poor Edgar Cano on 2017-06-09 12:35:14 -0500 commented: Curb has been mitigated. Thank you for sing 311. Issue Resolved 2745750 Caller states they have falgstone path on their parkway and have contracted a company to come repair this path on June 19th. Caller would like to know if they require a permit to do so . 713 Ingleside Place, Evanston, IL, United States Jan Hackman on 2017-07-05 07:54:18 -0500 commented: If you are keeping the same size, placement and material, you do not need a building permit. Not sure about the Right of Way which is your parkway. Sue Pontarelli on 2017-07-03 06:53:01 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli Pelayo Enerio on 2017-06-26 16:19:51 -0500 commented: Jan - question is private property installation. Yvette Hopson(311) on 2017-06-26 15:59:46 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Paul D'Agostino on 2017-06-16 08:03:58 -0500 commented: Jhun, There is no permit necessary from Forestry. But there is a second question regarding a permit for work on private property, which we cannot answer. Pelayo Enerio on 2017-06-12 14:14:20 -0500 commented: Resetting one piece of flagstone by the tree in the parkway was referred to forestry. Edgar Cano on 2017-06-12 06:58:58 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Community development to follow up with permit information. Thank you for using 311. Anita Gewurz on 2017-06-09 15:59:13 -0500 commented: Re: above, please note that this repair is needed because the roots of the parkway tree have cracked the flagstone paver, creating a Miscategorized 384 of 549 Id Description Address Comments Type 2747214 Caller is reporting on the East side of the 800 Block of Asbury about a half block North of Madison and a block South of Main there is a section of curb cut that is not handi-cap accessible(difficult for people in wheel chairs to cross) from the street to the sidewalk. Caller is requesting that this curb be evaluated and that a ramp or some alternative be installed to make the curb easier to negotiate. 800 Asbury Avenue, Evanston, IL, United States Henry Daniels on 2017-07-12 07:47:09 -0500 commented: This location has been added to the 2017 50/50 Program's first round. Henry Daniels on 2017-07-05 07:03:53 -0500 commented: Reviewing location. Sue Pontarelli on 2017-07-03 06:53:24 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli Rajeev Dahal on 2017-06-19 10:38:39 -0500 commented: Reviewed the location and not certain exactly where the request is for. However, if it is by the alley by 801 Asbury we will pursue to see if this can be included in the 50/50 sidewalk program. Rajeev Dahal on 2017-06-12 14:19:00 -0500 commented: We will review the location. 50/50 Program 2784936 The sidewalk directly in front of the house continues to be displaced. Please evaluate for potential replacement. Thank you and we look forward to your feedback. 915 Isabella St, Evanston, IL 60201, USA Henry Daniels on 2017-06-21 06:54:14 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. Thank you for using 311! Edgar Cano on 2017-06-20 14:50:56 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 2799721 tree grate buckled near peckish pig 633 Howard Street, Evanston, IL 60202, USA Matthew Basile on 2017-07-07 08:05:59 -0500 commented: We have scheduled a crew to fix the grates. Thank you for your concern for Evanston's urban forest and for using the City of Evanston 311 system. Matthew Basile on 2017-06-27 21:51:54 -0500 commented: Due to a higher than normal demand for forestry inspections, we have extended the expected completion date of this request. Thank you for your concern for Evanston's urban forest! Kevin Ward on 2017-06-22 14:44:23 -0500 commented: We have received your request and we will schedule an inspection. Miscategorized 2799779 buckled tree grate. not by peckish but 703 Howard. 703 Howard Street, Evanston, IL 60202, USA Matthew Basile on 2017-07-07 08:04:54 -0500 commented: We have scheduled a crew to fix the grate. Thank you for your concern for Evanston's urban forest and for using the City of Evanston 311 system. Matthew Basile on 2017-06-27 21:46:02 -0500 commented: Due to a higher than normal demand for forestry inspections, we have extended the expected completion date of this request. Thank you for your concern for Evanston's urban forest! Kevin Ward on 2017-06-22 14:43:30 -0500 commented: We have received your request and we will schedule an inspection. Miscategorized 385 of 549 Id Description Address Comments Type 2799875 Caller states that she noticed that her sidewalk is starting to sag; she believes it has to do with the construction that is going on on the street. She would like the sidewalk to be looked at to see if the sidewalk has been damaged because of the banging at the street. 1006 Darrow Avenue, Evanston, IL, United States Edgar Cano on 2017-06-27 12:12:12 -0500 commented: Spoke with resident on site. It does not appear that the road construction was the cause of any settling. Resident will be contacting 311 for information regarding the 50/50 program. Thank you for using 311. 50/50 Program 2809024 Here is a picture of the curb; although I've not been in a wheelchair before I have had to use a cane and a walker in the past. The unevenness of this curb would have been a hazard for me. This is on the northwest corner of Reba Place and Custer. Thank you, Casey Christensen 60 1 Linden Place Reba Pl and Custer Edgar Cano on 2017-06-29 15:00:44 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2809560 there is a 36 inch deep sink hole in our parkway - right near the light. since it is the parkway, i assume this is something the city takes care of? it should likely get filled in asap so someone doesn't fall into it. thanks. 1607 Lake St, Evanston, IL 60201, USA Robert Bauer on 2017-06-29 06:40:14 -0500 commented: Dye test was positive and a repair is scheduled the week of July 3rd. Robert Bauer on 2017-06-27 15:25:38 -0500 commented: City Sewer crews placed a barricade over void and will preform a dye test and CCTV inspection on Wednesday 6-28-2017. Edgar Cano on 2017-06-27 14:21:17 -0500 commented: Transferred to sewer department for inspection. Miscategorized 2810924 Curb at the alley needs to be repaired; a chunk is missing--between Cowper and Hastings on the south side of the street. 3214 Colfax Street, Evanston, IL, United States Edgar Cano on 2017-06-29 14:59:47 -0500 commented: Curb has been mitigated. Thank you for using 311. Issue Resolved 2813728 Caller states the dip into the street for pedestrians on north side of Mcdaniel both sides has too big of a drop for wheel chair to enter the street and cross. mcdaniel and Park Evanston, IL 60201, USA Kurt Little on 2017-07-08 06:55:42 -0500 commented: Thank you for doing the work so promptly. These little things make a big difference for those with accessibility issues. Kurt Little on 2017-07-08 06:55:05 -0500 commented: Very good John Jaminski on 2017-07-06 12:35:43 -0500 commented: repairs complete. Thank you for using 311. Edgar Cano on 2017-06-29 15:12:52 -0500 commented: Area was surveyed and repairs have been scheduled. Thank you for using 311. Issue Resolved 386 of 549 Id Description Address Comments Type 2822903 Sidewalk is a trip hazard and caller would like to have it evaluated for repair. 3320 Colfax Place, Evanston, IL, United States Henry Daniels on 2017-07-19 07:51:08 -0500 commented: Participant Information Letter sent. Yvette Hopson(311) on 2017-07-18 20:25:06 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Edgar Cano on 2017-07-14 15:24:39 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program if interested. Thank you for using 311. Jesse Ramsay (311) on 2017-07-12 16:22:36 -0500 commented: Caller advised she is selling her house and the sidewalk is still in dangerous condition. She would like further repairs. She believes that the repairs were done at wrong address. She says possibly the work was done at Colfax street instead of her location at Colfax Place. Edgar Cano on 2017-06-29 14:39:47 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. 50/50 Program 2827899 Cracks in side-walk in front of house - making surface uneven and potential tripping hazard. 2523 Harrison Street, Evanston, IL, United States Henry Daniels on 2017-07-05 07:05:23 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-06-30 14:29:32 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. Sandra Hernandez (311) on 2017-06-30 13:14:55 -0500 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed for the 4th of July Holiday Tuesday 7/4/2017. City offices will re-open on Wednesday 7/5/2017. 311 is available on line 24/7 www.cityofevanston.org or please contact us at 311 or 847-448-4311 Monday 7/3/2017 7:00am - 7:00pm Tuesday 7/4/2017 7:00am - 10:00pm Wednesday 7/5/2017 7:00am - 7:00pm 50/50 Program 387 of 549 Id Description Address Comments Type 2831314 This is not an issue with the sidewalk itself, but with the visibility of the sidewalk from the alley which poses a risk to pedestrians and bikers on the sidewalk as there is zero visibility, even at slow speed. A parabolic mirror placed on the utility pole and facing the alley would help improve visibility and provide improved safety. 316 Keeney St, Evanston, IL 60202, USA James Maiworm on 2017-07-03 11:49:21 -0500 commented: Good Morning, The location you have indicated was inspected today. It appears that a planting of shrubs on private property is causing the vision obstruction. When this occurs notification is sent to the property owner to cut back/trim the shrubs to improve visibility. Notices will be sent to the property owner. At this time the City does not install the "fish eye" mirror you have mentioned. Have a great fourth of July. . Tom Twigg on 2017-07-03 11:41:53 -0500 commented: Jim, The City does not install mirrors. I checked the alley this morning and exiting the alley northbound, site distance is good looking west, but blocked when looking east due to an over grown private bush. Maybe the summer youth can trim or Greenways can get involved and force the owner to trim. Miscategorized 2840469 Caller reports a damaged paver leaving a hole in the sidewalk. 1711 Sherman Avenue, Evanston, IL, United States John Jaminski on 2017-07-03 14:42:02 -0500 commented: repaired thank you for using 311. Issue Resolved 2847233 Caller reports that after RCN installed cable, they left the sidewalk in disrepair, with black tar used as a fix. Caller states that the current condition left is uneven. The area is on the north side of the street. 800 Crain Street, Evanston, IL, United States Pelayo Enerio on 2017-07-11 13:55:27 -0500 commented: This was reported to RCN and the final restoration is in coming weeks. John Jaminski on 2017-07-06 07:13:39 -0500 commented: right of way concern -not streets Issue Resolved 2847240 Caller reports that after RCN installed cable, they left the sidewalk in disrepair, with black tar used as a fix. Caller states that the current condition left is uneven. The area is on the north side of the street. 900 Crain Street, Evanston, IL, United States Pelayo Enerio on 2017-07-11 13:54:00 -0500 commented: This was reported to RCN and final restoration will be in coming weeks. John Jaminski on 2017-07-06 07:12:52 -0500 commented: Right of way concern -not streets Issue Resolved 2854337 Caller states on his block yesterday the city used asphalt to repair cracks on the sidewalk throughout the block. Caller states it looks terrible and why was it done. Caller's neighbors are complaining to him. 1101 Monroe Street, Evanston, IL, United States John Jaminski on 2017-07-06 15:13:33 -0500 commented: explained to resident. Issue Resolved 388 of 549 Id Description Address Comments Type 2862580 The public sidewalk has been been cracking over the years. The city crew placed some fill in as a temporary measure, recently. He stated that it would be completed with the street sidewalk repairs. I left a message with the city's 311 operator, requesting instructions on what to do. She did submit the request, nothing has been received as of yet. Thanks! I would like for that to be completed as soon as possible. 2106 Dobson St, Evanston, IL 60202, USA Henry Daniels on 2017-07-13 08:04:27 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to email address. The letter will explain the next steps that need to be taken. Thank you for using 311! 50/50 Program 2863252 I recently discovered the City of Evanston accidentally cemented in my steel flower bed divider when they installed a curb in our alley (see pic). I cannot free the flower bed divider from the cement and ask the City to come over and free it from the concrete. 2404 Ashland Ave, Evanston, IL 60201, USA Trev Minnaert on 2017-07-10 16:51:43 -0500 commented: Please reopen this issue...the flower bed divider is in fact stuck in the cement...we dug down and tried to free it with a steel chisel and the chisel kept hitting the cement...please rectify the situation without ruining the cement curb. John Jaminski on 2017-07-10 14:42:44 -0500 commented: Site checked and and fence is probably root bound not stuck in concrete. thank you for using 311. Miscategorized 2875600 Caller states that there is a raised slab that she fell on and it hasn't been fixed. This is her 2nd time reporting this. 1730 Cleveland Street, Evanston, IL, United States Edgar Cano on 2017-07-13 14:46:54 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2878289 Caller advises the sidewalk is not level.2320 Greenwood Street, Evanston, IL, United States Edgar Cano on 2017-07-14 15:25:17 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2879771 Bus stop advertisement falling off top (see attached. NW corner of Main & Dodge 900 Dodge Avenue, Evanston, IL, United States Edgar Cano on 2017-07-12 15:01:46 -0500 commented: Sign has been removed. Thank you for using 311. Issue Resolved 2907495 Resident stopped in to report elevated sidewalk at 2669 Prairie. Resident requesting evaluation of sidewalk and temporary patching. Is also interested in obtaining information about 50/50 Sidewalk replacement. 2669 Prairie Avenue, Evanston, IL, United States Henry Daniels on 2017-07-25 17:34:59 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Sue Pontarelli on 2017-07-25 13:29:09 -0500 commented: Please review this request it is overdue. Thank you. Sue Pontarelli Yvette Hopson(311) on 2017-07-24 15:47:47 -0500 commented: Please review this request, it is overdue. Thanks, Yvette Paulina Albazi on 2017-07-20 08:44:25 -0500 commented: Resident called to thank staff for the quick response to this issue. Edgar Cano on 2017-07-18 15:11:42 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 389 of 549 Id Description Address Comments Type 2913854 Caller fell last week on cracked sidewalk in front of location. Caller will make a police report but caller wanted sidewalk fixed 927 Noyes Street, Evanston, IL, United States Edgar Cano on 2017-07-21 14:52:42 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2919980 Please clear sidewalks Dewey Ave & Foster St,Evanston, IL 60201 Stephen Walker on 2017-07-21 13:57:20 -0500 commented: Thank you for bringing this to our attention. Sidewalk has been cleared. Issue Resolved 2922038 Caller reports there is debris and dirt on the sidewalk at the base of the metra steps by Harrison. Caller states this is caused by erosion of the embankment along the side of the tracks. Can the city clean the sidewalk? Central and Harrison, Evanston, IL Edgar Cano on 2017-07-21 15:29:10 -0500 commented: Debris has been removed. Thank you for using 311. Issue Resolved 2922160 Resident reports the sidewalk on the south side of the 800 Block of Mulford is very uneven due to tree roots pushing up the concrete. Caller reports this is a hazard and that she has fallen in the past. Can the city repair this sidewalk 800 Mulford Street, Evanston, IL, United States Lynne Creighton on 2017-08-04 08:44:05 -0500 commented: Bad! Lynne Creighton on 2017-08-04 08:44:20 -0500 commented: Very good Lynne Creighton on 2017-08-04 08:41:04 -0500 commented: This work that was requested is unacceptable. The rises in the sidewalk that were filled we\'re only partially filled and not even fully tap down to make a smooth surface. These areas are in front of 806–808 Mulford. I will be calling to talk to someone. Lynne Creighton on 2017-08-04 08:40:26 -0500 commented: Very good Henry Daniels on 2017-08-03 14:17:17 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Kevin Ward on 2017-07-26 14:46:07 -0500 commented: Unable to inspect tree extending due date. Edgar Cano on 2017-07-21 14:22:56 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to Forestry department for tree root inspection. Thank you for using 311. 50/50 Program 2951700 Caller reports there is one sidewalk square by the tree that is uneven, causing a tripping hazard. 1324 Central Street, Evanston, IL, United States Edgar Cano on 2017-08-02 15:02:43 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 2951975 Broken sidewalk on Dewey side of address. Caller would like to have it repaired. She advised that it fills with water in the winter and freezes over as well as being a trip hazard. Caller wished to add that many people have fallen due to the cracked and broken sidewalk. 1623 Crain Street, Evanston, IL, United States Henry Daniels on 2017-08-01 19:50:03 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-07-28 11:53:05 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 390 of 549 Id Description Address Comments Type 2965047 Caller would like to know when the sidewalk repair will begin/end - several parking spaces are blocked off but no work appears to be happening. 1600 Chicago Avenue, Evanston, IL, United States Henry Daniels on 2017-08-18 14:39:10 -0500 commented: Spoke with resident. Christopher Polinski(311) on 2017-08-09 16:12:43 -0500 commented: Received a call from Caller today 8/9/2017. Caller received the note advising that the work has been completed and the postings/ barricades were removed but stated that it is not accurate and that no work on the sidewalk has been done. Caller requested to speak with Hank Daniels directly. SDO-311 transferred Caller upon request, Caller received Voice Mail. Henry Daniels on 2017-08-09 14:05:03 -0500 commented: Work has been completed, postings and barricades have been removed. Thank you for using 311! Jesse Ramsay (311) on 2017-08-07 09:35:13 -0500 commented: Caller called to advise that work has barely been started and the street and sidewalk are blocked off. It is an inconvenience to have all the area blocked off for 3 weeks but no work being done. Caller would like to know when the work will be completed, as the last comment indicated it would be finished near August 4th. Henry Daniels on 2017-08-01 19:30:40 -0500 commented: The Sidewalk Replacement Program will conclude the end of this week. Issue Resolved 2968153 Caller states that there are unsightly black spots on the sidewalk and he would like to know where they came from or what caused it. 1508 Hinman Avenue, Evanston, IL, United States Norbert Simon on 2017-08-02 19:39:07 -0500 commented: Good Edgar Cano on 2017-08-02 12:57:25 -0500 commented: Spoke with resident via phone. Spots seem to be gum on pavement. Thank you for using 311. Issue Resolved 2968178 Caller would like the construction horses (2) and cement debris that was left behind after the sidewalk replacement removed. 2509 Thayer Street, Evanston, IL, United States Henry Daniels on 2017-08-01 19:37:38 -0500 commented: The clean up/restoration crew, if they haven't already, will be at your location soon this week. Sorry for any inconvenience this may have caused. Issue Resolved 2970454 Sidewalks were replaced but the barricades and other construction material was left behind - please remove. 2245 Central Park Avenue, Evanston, IL, United States Henry Daniels on 2017-08-02 07:39:42 -0500 commented: The clean up/restoration crew, if they haven't already, will be at your location soon this week. Sorry for any inconvenience this may have caused. Issue Resolved 2975424 Caller is reporting that the Streets Division was out last week replacing her sidewalk but they have yet to come back and finish the replacement. Caller is requesting a status update on when Streets will be back to finish up. 923 Michigan Avenue, Evanston, IL, United States Henry Daniels on 2017-08-03 14:21:38 -0500 commented: I visited location today and made walkway passable. The clean up/restoration crew, if they haven't already, will be at your location soon this week. Sorry for any inconvenience this may have caused. Edgar Cano on 2017-08-02 15:14:14 -0500 commented: Streets department has not performed recent repairs at that location. Sent over to 50/50 program for follow up. Thank you for using 311. 50/50 Program 391 of 549 Id Description Address Comments Type 2977319 Report of barricades left over after sidewalk work completed, east side of the street on Lincolnwood Drive, north of Harrison Street. Lincolnwood Drive & Harrison Street, Evanston, IL Henry Daniels on 2017-08-03 14:19:55 -0500 commented: I visited location today and made walkway passable. The clean up/restoration crew, if they haven't already, will be at your location soon this week. Sorry for any inconvenience this may have caused. Issue Resolved 2998390 Brick sidewalk is in need of repair. It's warped and a tripping danger. I fell and scrapped my elbow and hand last night (Monday, August 7, 2017) approaching my parked car. 1734 Orrington Ave, Evanston, IL 60201, USA Edgar Cano on 2017-08-09 15:06:12 -0500 commented: Carriage walk has been mitigated. Thank you for using 311. Issue Resolved 3001261 Caller is reporting that the sidewalk pavers at the North East corner of Keeney & Chicago and uneven. Caller is requesting that the sidewalk be repaired. Keeney & Chicago Evanston Edgar Cano on 2017-08-09 15:03:39 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3002474 The sidewalk on the side of the church is uneven, I have almost tripped. This is unsafe because people can fall and hurt them. 1001 Church St,Evanston, IL 60201 Edgar Cano on 2017-08-10 15:07:52 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3003948 Uneven sidewalk in front of 706 Oakton; she states that snow or water turn into ice during the winter. She would like the sidewalk repaired. 706 Oakton Street, Evanston, IL, United States Henry Daniels on 2017-08-18 14:46:30 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-11 12:51:25 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3010547 On the NW corner of Lincoln and Jackson, there is a very thorny & overgrown shrub extending half way across the sidewalks on both Lincoln and Jackson. It scratches people walking by and it impedes anyone with a stroller or walker from using the sidewalk. It is on the property owner's side of the sidewalk -- not on the parkway -- and this owner rarely mows the lawn and hasn't trimmed this bush in a few (or several) years. Is there anything the City can do, or is this something only the property owner can trim? 2422-2438 Jackson Ave, Evanston, IL 60201, USA Paul D'Agostino on 2017-10-13 13:46:05 -0500 commented: Staff inspected the site on 10/13 and found that the shrubs have been cut back and no longer hang over the sidewalk. Donna Luteri on 2017-09-12 07:53:43 -0500 commented: Attached letter has been sent to property owner via certified mail. Extending due date for compliance inspection. Donna Luteri on 2017-09-12 07:53:04 -0500 commented: Please send a letter to 1501 Lincoln requesting they trim back the barberry at the corner so that it does not block the sidewalks in either direction. Paul D'Agostino on 2017-08-15 16:11:43 -0500 commented: This property was inspected on 8/15, and we will send a letter to the owner requiring them to trim back the barberry so it does not block the sidewalk. They will have 30 days to comply with this request. Miscategorized 392 of 549 Id Description Address Comments Type 3011283 Information from 311 Web Chat. I live in the condo building on the corner of Main St. and Michigan Ave. There is a condo building just to our West, closer to Lincoln Elementary. When you are facing the front of their building, the left side of their yard is a pile of dirt without any plantings. When it rains, the mud covers the sidewalk and is EXTREMELY slippery. I am not sure what is in that mud, but I have witnessed several neighbors almost fall down and I am concerned someone will be injured. It is like walking on ice! Is there anything we can do about that? As I said, it is only an issue when it rains and the mud pours onto the sidewalk. Once dry, all is well. 222 Main Street, Evanston, IL, United States Mark Kasperski on 2017-08-14 08:57:19 -0500 commented: Complaint closed PM violation will be followed through database 17-1045 Mark Kasperski on 2017-08-11 14:10:50 -0500 commented: Complaint verified, door hanger posted. Ground cover required Kimberly Snider on 2017-08-10 15:59:41 -0500 commented: Thank you for submitting your request using the 311 system. At this time, your request requires further investigation for compliance. Your request has been assigned a new reference number, 17-1045 . For status updates on your request, please contact 311. Beverly Otey (311) on 2017-08-10 15:04:14 -0500 commented: Resident stated "I believe it is 222 Main St. Taller dark brown brick building with the main entrance facing Main St. " Issue Resolved 3026763 Caller reports a damaged sidewalk slab on Maple Avenue, west side of the street, between Grove St. & Davis St., near parking meter #1158. Maple Avenue & Grove Street, Evanston, IL Edgar Cano on 2017-08-16 11:25:55 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3040439 I would like to be placed on the 50/50 Sidewalk Program list. Thanks! 1215 Cleveland St, Evanston, IL 60202, USA Henry Daniels on 2017-08-18 14:43:36 -0500 commented: A 50/50 Sidewalk Participation Letter was sent to address. The letter will explain the next steps that need to be taken. Thank you for using 311! Edgar Cano on 2017-08-17 12:30:41 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3044266 Caller reports there is a very deep hole in the sidewalk in front of this address. Caller was walking with her children and the stroller got stuck in the hole. Resident is asking for repair as soon as possible, so someone is not injured. 1120 Lake Street, Evanston, IL, United States Edgar Cano on 2017-08-18 11:30:05 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3052106 By the fire hydrant close to the driveway there is a raised slab that is a trip hazard. 753 Custer Avenue, Evanston, IL, United States Edgar Cano on 2017-08-21 14:47:08 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3063352 Needs to be fixed. Can be a trip hazard Benson Ave & Church St,Evanston, IL 60201 Edgar Cano on 2017-08-23 13:01:19 -0500 commented: Pothole have been filled. Thank you for using 311. Issue Resolved 393 of 549 Id Description Address Comments Type 3069289 Our neighbor brought to our attention a damaged sidewalk tile in front of our building at 1213/1215 Mulford. Tree roots have been pushing it up gradually but just recently this has increased dramatically and has become a tripping hazard. Would the city cover this repair since it is caused by a tree on the parkway? Attaching two photos for your review. Any advice or assistance is greatly appreciated as always. Best, Scott & Lisa Howard 1215 Mulford 1213-1215 Mulford Edgar Cano on 2017-08-28 14:00:27 -0500 commented: Sidewalk has been mitigated and cleaned. Thank you for using 311. Akilah Hagler (311) on 2017-08-28 10:12:00 -0500 commented: Resident reports the following: I was thrilled that the City responded quickly and patched our damaged sidewalk. Thank you for pushing our request through the appropriate channel. However, I am quite disappointed with the clean-up which the guys side they'd come back to do. The barricades are gone and the two sidewalk squares are a mess. Maybe I'm asking too much, but is there anything that can be done to clean-up the repair work so it doesn't look like someone spilled cement everywhere? We have a unit for sale in the building and this mess is an eye sore. Issue Resolved 3080920 Across the street from the YMCA entrance there is a whole/indent in the ground (grass covered) that is deep and dangerous. 1000 Grove Street, Evanston, IL, United States Edgar Cano on 2017-08-29 11:47:21 -0500 commented: Indentation has been filled. Thank you for using 311. Issue Resolved 3088343 Public Works, In June we paid the City of Evanston $388.82 for the replacement of four sidewalk slabs under the 50/50 replacement scheme. However, one of the slabs, immediately east of the sidewalk on Hinman by the back gate, was not replaced. (Photo attached.) The cost for that slab was $94. Can we claim this back from the City? Thank you in advance for your attention to this request. Best, Alexa Hand, Managing Agent on behalf of the Hamilton Club Condo Assn. Board of Directors 1143 Hinman Ave, Evanston, IL 60202, USA on 2017-08-31 09:26:20 -0500 commented: Many thanks --we appreciate it! Henry Daniels on 2017-08-31 07:01:14 -0500 commented: Sorry for the missed slab replacement, this will be replaced in the second round in late September. Thanks, Hank 50/50 Program 394 of 549 Id Description Address Comments Type 3092311 Caller states that every time it rains the sidewalk in front of his home gets flooded. He would like the city to look into it and see if there is anything that can be done. 1726 Darrow Avenue, Evanston, IL, United States Henry Daniels on 2017-09-01 16:03:23 -0500 commented: Mr. Marlin, Go to the link below and complete and submit the form. The second round of the 50/50 Program will start sometime in late September. www.cityofevanston.org/5050 Thanks, Edgar Cano on 2017-08-30 13:30:12 -0500 commented: Spoke with Mr. Marlin via phone on 8/30/17. Sidewalk was surveyed and no issues to mitigate were found. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3094898 This home owner finally trimmed their bushes (so the sidewalk is passable), but SWEPT THEIR TRIMMINGS INTO THE STREET. Please ticket them so they learn how to be a good neighbor and clean up after themselves. 225 Hamilton St,Evanston, IL 60202 on 2017-09-13 21:49:27 -0500 commented: Thank you for responding. I appreciate it. Robert Kramer on 2017-09-06 10:12:03 -0500 commented: It does looks much better. II guess this falls under the category of substantial compliance although I will call them today and see if I can get the pile of trimmings on the far north removed. Thanks you for reporting this. on 2017-09-04 10:12:03 -0500 commented: Well, they cleaned up the south half and left the north half. Thanks for trying. on 2017-08-31 10:34:11 -0500 commented: Thank you very much. Robert Kramer on 2017-08-31 10:31:19 -0500 commented: A request to clean up the street was left at the address. A reinspection will take place on Sept. 5th .Additionally I reported this to Edgar in Streets on 2017-08-30 13:05:27 -0500 commented: Thank you! The sidewalk had this debris in it all summer and was a tripping hazard. Now it's in the street. Parking is harder and can damage cars, turn ankles etc. I also don't want the street clean up crew to have to pick up this crap that we as owners are responsible for. Kimberly Snider on 2017-08-30 10:11:04 -0500 commented: Thank you for submitting your request using the 311 system. At this time, your request requires further investigation for compliance. Your request has been assigned a new reference number, 17-1134 . For status updates on your request, please contact 311. Miscategorized 395 of 549 Id Description Address Comments Type 3095834 Bush overgrown into sidewalk blocking a clear walkway 1838-1898 Darrow Ave, Evanston, IL 60201, USA Robert Kramer on 2017-09-06 08:16:07 -0500 commented: A compliance inspection will take place on 9 14-17 Kimberly Snider on 2017-09-05 13:53:26 -0500 commented: Thank you for submitting your request using the 311 system. At this time, your request requires further investigation for compliance. Your request has been assigned a new reference number, 17-1159 and 17- 0986. For status updates on your request, please contact 311. Robert Kramer on 2017-08-31 10:29:09 -0500 commented: I have sent requests to both 1831 and 1835 Darrow to cut the encroaching bushes by 7-14-17 Kimberly Snider on 2017-08-30 10:46:02 -0500 commented: Bob, Please inspect and determine address. Thanks, Kim Miscategorized 3101206 Large puddle at base of southern stairs for east bound platform. Not sure if it is City property or should be addressed by Union Pacific 1826 Central Street, Evanston, IL, United States Edgar Cano on 2017-09-06 15:46:40 -0500 commented: Area was surveyed 3 times and no puddles or visible low spots were found on city property. Will notify CTA to inspect their area as well. Thank you for using 311. Jesse McPhail(311) on 2017-08-31 09:49:54 -0500 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed for the Labor Day Holiday 09/04/2017. City offices will re-open on Tuesday 09/05/2017. 311 is available on line 24/7 www.cityofevanston.org or please contact us at 311 or 847-448-4311 Friday September 1, 2017 7:00am - 7:00pm Tuesday September 5, 2017 7:00am - 7:00pm Issue Resolved 3108064 After Nicor work was done sidewalk slabs were fixed with asphalt rather than concrete. Caller states the asphalt is uneven and the sidewalk should be restored to its original condition using concrete. 2942 Central Street, Evanston, IL, United States Ann Goldshaft on 2017-09-06 13:56:38 -0500 commented: Very poor Pelayo Enerio on 2017-09-06 13:21:12 -0500 commented: Called and left a message to Ann Goldshaft that the temporary restoration will be permanent upon completion of the gas main and services are installed. Issue Resolved 396 of 549 Id Description Address Comments Type 3113252 There are two sidewalk panels in front of 3023 Thayer St. in Evanston that were stepped in by children before they dried and we have a pair of them but would like to have both the panels actually replaced and will be happy to pay for. Can someone please call me at 312–933-87692 arrange a request for a work order. Thank you Peter Dodzik 3023 Thayer St, Evanston, IL 60201, USA Henry Daniels on 2017-09-07 12:54:34 -0500 commented: An informational letter about the 50/50 Sidewalk replacement Program will be sent to the homeowner. Sue Pontarelli on 2017-09-04 09:44:20 -0500 commented: Thank you for using the City of Evanston 311 Center. Please note that the City of Evanston Offices will be closed for the Labor Day Holiday 09/04/2017. City offices will re-open on Tuesday 09/05/2017. 311 is available on line 24/7 www.cityofevanston.org or please contact us at 311 or 847-448-4311 Friday September 1, 2017 7:00am - 7:00pm Tuesday September 5, 2017 7:00am - 7:00pm Please note that effective 9/2/2017 311 will be closed on Saturdays. 50/50 Program 3139848 Why are there no sidewalks in the 1500-1600 blocks of Dobson? 1600–1698 Dobson St,Evanston, IL 60202 Rajeev Dahal on 2017-09-14 15:09:43 -0500 commented: Dear Resident: We have reviewed your request the location. There are sidewalk gaps through-out the City and we assume that the property owners did not want sidewalk in the front as they did not want to reduce the lawn area, due to tree impact concerns or other reasons. The property owners in the block have the option to consider it, and if they are in agreement submit a petition to the City. The funding source will need to be identified to construct the sidewalk including 50/50 cost share program similar to the 50/50 sidewalk replacement program. Then the City will conduct topographic survey, identify impacts (trees, etc…) prepare construction plans and bid the project. Regards Rajeev Dahal Senior Project Manager Capital Planning & Engineering 50/50 Program 3141516 The bike/walking path in Harbert Park (1300 McDaniel), east of canal at Lee street, is uneven and collects water when it rains. Is in need of some repair. Via walk up citizen at Streets Alive. Lee and McDaniel Stephen Walker on 2017-09-14 11:55:09 -0500 commented: This request has been forwarded to the Capital Improvement team for consideration. Thank you for using 311. Miscategorized 397 of 549 Id Description Address Comments Type 3158240 Caller reports the sidewalk in front of this address is damaged by tree roots and uneven. On Saturday, Mr. Jones tripped and fell. He is asking the city to evaluate and repair the sidewalk as it is a hazard. Mr. Jones lives at 1418 Wesley. 1424 Wesley Avenue, Evanston, IL, United States Henry Daniels on 2017-09-19 11:33:53 -0500 commented: Informational letter sent. Edgar Cano on 2017-09-18 13:12:21 -0500 commented: Spoke with Mr. Jones via telephone today 9/18/17. Differential settlement was found as possible cause of deflection. Sent over to the 50/50 program to inform homeowner of program. Thank you for using 311. Robert Bauer on 2017-09-15 15:06:14 -0500 commented: Sewer crews inspected and the test was negative. Edgar Cano on 2017-09-14 07:23:45 -0500 commented: The sidewalk was mitigated on September 12th. Request is being forwarded to sewer department for dye testing. Thank you for using 311. Beverly Otey (311) on 2017-09-11 14:03:23 -0500 commented: Mr. Jones did not want to file a claim with the legal department at this time. 50/50 Program 3196300 Citizen requests for the sidewalk to be cleaned at 614 Clark Street. He stated there is a lot of broken glass on the sidewalk from what he thinks seems to be from broken bottles. 614 Clark Street, Evanston, IL, United States Vonnie Moore on 2017-09-18 15:35:02 -0500 commented: Upon inspection today by city crews, no glass was found at this location. Thank you for using the 311 system. Vonnie Moore on 2017-09-18 07:00:29 -0500 commented: We have received your 311 request and will address your concerns as soon as possible. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Issue Resolved 3228682 There has for a couple of weeks now been broken glass at the base of the ramp leading to the East (southbound) track. Thank you. 1826 Central St, Evanston, IL 60201, USA Kevin Johnson on 2017-09-29 12:32:53 -0500 commented: Upon repeated inspection there was no glass found. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Kevin Johnson on 2017-09-28 14:24:28 -0500 commented: This request due date will be extended due to the high volume of 311 requests. We will address your concerns as soon as possible. Thank you for using the 311 system. Kevin Johnson on 2017-09-25 12:58:37 -0500 commented: We have received your 311 request and will address your concerns as soon as possible. Thank you for your patience and your commitment to make Evanston the most livable city. Thank you for using 311. Issue Resolved 3230673 Caller advised that one of the bricks in the sidewalk collapsed and she fell in the hole. Caller was transferred to police desk for a police report. Area should be roped off as well as repaired 1640 Chicago Avenue, Evanston, IL, United States Edgar Cano on 2017-09-25 14:32:00 -0500 commented: Area has been mitigated. Thank you for using 311. Issue Resolved 398 of 549 Id Description Address Comments Type 3236115 Sidewalk in the front of the property needs replacement in several places. I am the owner of the residence and wish to participate in the 50/50 replacement program. 2138 Maple Ave, Evanston, IL 60201, USA Henry Daniels on 2017-09-27 07:15:25 -0500 commented: Information sent by email. Edgar Cano on 2017-09-26 11:56:21 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3236778 Caller states the barrier on the sidewalk was hit and not protecting bicyclists. 1723 Benson Ave, Evanston, IL 60201, USA Edgar Cano on 2017-09-28 14:57:50 -0500 commented: Barriers have been reset. Thank you for using 311. Nancy Sreenan on 2017-09-27 13:52:26 -0500 commented: It is *not* a "barrier on the sidewalk"! To clarify, in front of the Evanston Athletic Club (EAC) at 1723 Benson Ave., there is a bicycle parking corral which uses 2 car parking spaces for bicycle parking racks from approximately March thru December. This corral has a barriers/bollards that protect the bicycle parking by blocking not only the corral itself, but also the parking space to the north of the bicycle parking corral. The barrier has been removed by someone and is lying on the ground *in* the bike parking corral, so that that someone could use the car parking space that should be protecting the corral. One can see that this is the case because the bollard's base remains screwed into the pavement where the car should *not* be parking! Issue Resolved 3245841 Caller is reporting that on Lincoln adjacent to the Chandler Newberger Recreation Center there are some uneven sidewalk squares(North side of 900 Block of Lincoln St. /entrance to Chandler). Caller stated that this area is a trip hazard and to aid in preventing falls, Caller is requesting that the uneven sidewalk squares be marked in a bright color so pedestrians can tread carefully. 1028 Central Street, Evanston, IL, United States Edgar Cano on 2017-09-29 11:29:19 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3250355 Caller states that the sidewalk right by the entrance to Chandler Newberger and its playground is a trip hazard; her husband tripped and fell 9-28-17, she is requesting for the sidewalk to be repaired. 1028 Central Street, Evanston, IL, United States Edgar Cano on 2017-09-29 09:42:46 -0500 commented: Multiple service requests have been submitted for this issue and they have all been merged into the following ticket number #3245841 to avoid duplication and improve service delivery. You will continue to be notified of the status of this work through the new ticket number #3245841. Sidewalk in front of city property. Will look to correct in 2018. 3250688 The sidewalk brick is sinking and when it rains it creates puddles and ice in the winter. Caller also stated that the sidewalk bricks are sinking towards his building. 990 Grove Street, Evanston, IL, United States Edgar Cano on 2017-09-29 10:59:49 -0500 commented: Multiple service requests have been submitted for this issue and they have all been merged into the following ticket number #2522083 to avoid duplication and improve service delivery. You will continue to be notified of the status of this work through the new ticket number #2522083. private property 399 of 549 Id Description Address Comments Type 3280535 Would like to replace sidewalk slab in front of my home thru the 50/50 sidewalk improvement program . Would like to agree to the improvement prior to work. Thank you 2440 Bennett Ave, Evanston, IL 60201, USA Henry Daniels on 2017-10-06 14:18:28 -0500 commented: Information sent to email address. Edgar Cano on 2017-10-06 12:27:31 -0500 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3285110 On the east side of the street the sidewalk is disrupted from two trees that appear to have recently been cut down. 747 Dewey Ave,Evanston, IL 60202 Henry Daniels on 2017-10-11 07:36:06 -0500 commented: Johanna, Thank you for bringing this to our attention, this location will be added 2017 50/50 Sidewalk Replacement Program's second round. Hank Edgar Cano on 2017-10-10 15:00:40 -0500 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 3305452 Hole in parkway grass, next to curb, just north of building doorway 535 Custer Ave,Evanston, IL 60202 Edgar Cano on 2017-10-12 14:41:50 -0500 commented: Hole has been filled. Thank you for using 311. Issue Resolved 3312329 Caller states the sidewalk south of EAC there is a metal grates around trees and the grate is raised up and can be tripped on it. 1717 Benson Avenue, Evanston, IL, United States Kevin Ward on 2017-10-18 14:33:36 -0500 commented: We will schedule a crew to repair the grate.Thank you for using the 311 system Kevin Ward on 2017-10-16 07:53:53 -0500 commented: We have received your request and we will schedule an inspection. Miscategorized 3315066 Flagstone wall along road newly damaged and displaced. On west side of Ridge just north of Greenwood. 1400–1436 Ridge Ave,Evanston, IL 60201 Janet Gayes on 2017-10-16 17:44:58 -0500 commented: Thank you! Janet Gayes on 2017-10-16 17:38:52 -0500 commented: Very good Edgar Cano on 2017-10-16 14:55:52 -0500 commented: Wall section has been reset. Thank you for using 311. Issue Resolved 3315529 The sidewalk bricks in front of 1707 Benson are caving in. 1707 Benson Avenue, Evanston, IL, United States Edgar Cano on 2017-10-16 14:54:09 -0500 commented: Sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3318766 The Forestry Department cracked the curve and the sidewalk next to the parking spaces when removing a tree; caller is requesting the sidewalk be fixed 1614 Brummel Street, Evanston, IL, United States Edgar Cano on 2017-10-20 10:05:17 -0500 commented: Carriage walk has been fixed. Thank you for using 311. Issue Resolved 3363117 Jr League Thrift House advises that there are no grates around the tree on the sidewalk and that it is dangerous to customers. 920 Chicago Avenue, Evanston, IL, United States Kevin Ward on 2017-10-30 13:01:10 -0500 commented: A Certified Arborist with the City Of Evanston Forestry Division inspected the site and placed stone and mulch around the tree. We don't have grates for that small of an opening. Thank you for using the 311 system Kevin Ward on 2017-10-26 13:08:14 -0500 commented: We have received your request and we will schedule an inspection. Issue Resolved 400 of 549 Id Description Address Comments Type 3382084 Caller states the public sidewalk is very uneven and she fell and hurt her foot. Caller wants the city to address this sidewalk. 820 Davis Street, Evanston, IL, United States Edgar Cano on 2017-11-01 12:09:09 -0500 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3396469 Caller states a private contractor sign is on Central just east of the alley just west of Green Bay on the southside of the street. Caller states another on west side of GreenBay 100 feet north of central which is blocking the sidewalk and you cannot pass through. Caller states it has been a month and you cannot walk by and there is no construction going on. Central and Green bay Pelayo Enerio on 2017-11-03 16:48:24 -0500 commented: This was ComEd's emergent work related and was reported to them and will pick-up the signs today. Issue Resolved 3399170 There’s a huge puddle on the sidewalk on the south side of Lincoln just east of the crosswalk to Chandler Newburger. Can anything be done about this 1001-1181 Lincoln St, Evanston, IL 60201, USA Edgar Cano on 2017-11-07 13:23:29 -0600 commented: Sidewalk has been mitigated. We will monitor the area to check for condition. Thank you for using 311. Issue Resolved 3400325 where the tree is located by this address it is starting to up root the side walk bricks and the grate for the tree numerous people have tripped over this even me 1717 Benson Ave, Evanston, IL 60201, USA Edgar Cano on 2017-11-07 13:22:22 -0600 commented: Location has been mitigated. Thank you for using 311. Issue Resolved 3401431 Several pavers uneven in front of dry cleaners.1623 Chicago Ave, Evanston, IL 60201, USA Edgar Cano on 2017-11-07 13:21:45 -0600 commented: Pavers have been reset. Thank you for using 311. Issue Resolved 3419009 Caller reports in front of Bat 17 Restaurant, there are two sidewalk bricks that have sunk creating an uneven walkway. This creates a tripping hazard for pedestrians. 1707 Benson Avenue, Evanston, IL, United States Edgar Cano on 2017-11-13 14:52:29 -0600 commented: The sidewalk has been mitigated. Thank you for using 311. Issue Resolved 3495933 Slabs uneven.2549 Lawndale Avenue, Evanston, IL, United States Henry Daniels on 2017-12-05 08:12:49 -0600 commented: 50/50 Sidewalk Replacement Program Information has been sent address provided by email. You will be added to a list for Spring 2018 participation. Thank you for using 311! Edgar Cano on 2017-12-01 14:58:01 -0600 commented: This location has been mitigated. Transferred to the Capital Planning Bureau to follow up with 50/50 Sidewalk Program. Thank you for using 311. 50/50 Program 401 of 549 Id Description Address Comments Type 3526443 Sidewalk is raised due to tree roots - dangerous condition - on Elmwood side of house. 902 Monroe Street, Evanston, IL, United States Kevin Ward on 2017-12-13 10:41:56 -0600 commented: The street department will place asphalt on the uneven sidewalk area. Thank you for using the City of Evanston 311 Center. To view the status and details of your request, please follow the link to sign into your PublicStuff/311 account. Edgar Cano on 2017-12-08 15:41:16 -0600 commented: This location has been added the Streets Department list for mitigation inspection. Transferred to the Forestry department to check tree roots. Thank you for using 311. Issue Resolved 3547809 Report of broken stone/slab at the southwest corner of Main St. & Custer Ave. Main Street & Custer Avenue, Evanston, IL Akilah Hagler (311) on 2017-12-14 13:55:53 -0600 commented: Caller advises that this is a trip hazard and should be addressed soon. Issue Resolved 3547885 The sidewalk on Custer side of building has pavers and the pavers are sinking. The area is about 2 ft. x 2 ft. 700 Main Street, Evanston, IL, United States Issue Resolved 402 of 549 PLANNING & DEVELOPMENT COMMITTEE MEETING Monday, February 12, 2018 7:15 p.m. Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Evanston James C. Lytle Council Chambers AGENDA I. CALL TO ORDER/DECLARATION OF QUORUM: ALDERMAN WYNNE, CHAIR II. APPROVAL OF REGULAR MEETING MINUTES OF JANUARY 22, 2018 III. ITEMS FOR CONSIDERATION (P1) Resolution 10-R-18, Granting Municipal Use Exemption for Public Utility (Water Pump Station) at 2525 Church Street Staff and the Design and Project Review Committee (DAPR) recommend approval of Resolution 10-R-18 granting a Municipal Use Exception for the location of a Public Utility at 2525 Church Street in the OS Open Space District, where Public Utilities are neither a permitted or special use. For Action (P2) Ordinance 21-O-18, Special Use Permit for a Special Educational Institution – Public in the I2 General Industrial Zoning District The Zoning Board of Appeals and City staff recommend adoption of Ordinance 21-O-18 granting special use approval for a Special Educational Institution- Public in the I2 General Industrial Zoning District in order to operate a high-school for students with behavioral and emotional needs. The applicant has complied with all zoning requirements and meets all of the standards for a special use for this district. For Introduction (P3) Ordinance 14-O-18, Granting a Special Use for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street The Zoning Board of Appeals and City staff recommend adoption of Ordinance 14-O-18 granting special use approval for a Type 2 Restaurant, Rubies, at 1723 Simpson Street in the B1 Business District. This recommendation is conditional on the replacement of the building’s glass block windows with unobstructed transparent glass and removal of iron bars on windows and doors. The applicant has complied with all zoning requirements and meets all of the standards for a special use in this district. This Ordinance was held at committee for Introduction on January 22, 2018 until February 12, 2018. For Introduction 403 of 549 Planning & Development Committee Meeting Agenda February 12, 2018 IV. ITEMS FOR DISCUSSION (PD1) Lakefront Policy for Private Land Staff recommends that the City Council review, discuss and provide guidance in creating potential code amendments to the City’s Floodplain Ordinance (Title 4, Chapter 13) on private shoreline protection work and the potential expansion of private lakeshore property via fill of the public waters of Lake Michigan. For Discussion V. COMMUNICATIONS VI. ADJOURNMENT 404 of 549 Planning & Development Committee Meeting Minutes of January 22, 2018 7:15 p.m. James C. Lytle Council Chambers - Lorraine H. Morton Civic Center MEMBERS PRESENT: M. Wynne, A. Rainey, T. Suffredin, J. Fiske, E. Revelle, R. Rue Simmons, D. Wilson STAFF PRESENT: J. Leonard, M. Masoncup, S. Mangum OTHERS PRESENT: PRESIDING OFFICIAL: Ald. Wynne I. CALL TO ORDER/DECLARATION OF QUORUM: ALDERMAN WYNNE, CHAIR A quorum being present, Ald. Wynne called the meeting to order at 7:35 p.m. II. APPROVAL OF REGULAR MEETING MINUTES OF JANUARY 8, 2018 Ald. Fiske moved to approve the minutes of the January 8, 2018 meeting, seconded by Ald. Wilson. The committee voted unanimously 7-0, to approve the January 8, 2018 minutes. III. ITEMS FOR CONSIDERATION (P1) Vacation Rental License for 710 Madison Street City staff recommends City Council approval of a Vacation Rental License for the property located at 710 Madison Street. The Vacation Rental meets all of the Standards and Procedures for license approval. For Action Ald. Fleming requested to hold to the item until February 26, 2018 to work with the property owner and staff. Ald. Wilson moved to hold the item until the February 26, 2018 Planning and Development Committee meeting, seconded by Ald. Rue Simmons. The Committee voted unanimously, 7-0 to hold the item. (P2) Ordinance 7-O-18, Granting a Special Use for a Type 2 Restaurant, Colectivo Coffee, at 716 Church Street The Zoning Board of Appeals and City staff recommend adoption of Ordinance 7-O-18 granting special use approval for a Type 2 Restaurant, Colectivo Coffee, at 716 Church Street in the D3 Downtown Core DRAFT 405 of 549 Planning & Development Committee Meeting Page 2 of 10 Minutes of January 22, 2018 Development District. The applicant has complied with all zoning requirements and meets all of the standards for a special use for this district. Alderman Fiske recommends suspension of the rules for Introduction and Action at the January 22, 2018 City Council meeting. For Introduction and Action Ald. Wilson moved to suspend the rules and recommend introduction and action of Ordinance 7-O-18, seconded by Ald. Revelle. The Committee voted unanimously, 7-0, to Introduce and Approve Ordinance 7-O-18. (P3) Ordinance 13-O-18, Granting a Special Use for the Expansion of a Religious Institution and Major Zoning Relief for a Third Story Addition at 2014 Orrington Avenue The Zoning Board of Appeals and City staff recommend adoption of Ordinance 13-O-18 granting special use approval for the expansion of a Religious Institution, Lubavitch Chabad of Evanston, and major zoning relief for a third story addition, in the R1 Single Family Residential District. The applicant has complied with all zoning requirements and meets all of the standards for special use and major variations for this district. For Introduction David Shoenfeld, 2039 Orrington, speaking for 10 neighbors, stated concerns of institutional intrusion and irrevocably converting to a nonresidential use. Mr. Shoenfeld suggested conditions agreed to by the applicant addressing concerns about termination of the use upon Chabad’s departure. The ZBA changed these conditions and the neighbors ask to include the conditions in the ordinance. Ald. Fiske, referenced the neighbors and property owner’s agreement, and suggested that the Committee amend the motion to include conditions regarding the use of premises and to limit the special use to Lubavich Chabad. Deputy City Attorney Masoncup, stated that per the zoning code a special use runs with the land, not with the owner except for unique circumstances. Further, RLUIPA protections require a compelling government interest to treat differently than other religious institutions. Ald. Fiske, stated that these issue were included in 1978 Ordinance and covenant and requested that these issues are explored in the next two weeks to discuss with neighbors and staff. Ald. Wilson, noted that it is important to protect the process and rights and is uncomfortable deviating from the ordinance as written. Ald. Revelle, noted that the record would reflect that Chabad is in agreement with proposed restriction. 406 of 549 Planning & Development Committee Meeting Page 3 of 10 Minutes of January 22, 2018 Deputy City Attorney Masoncup stated that staff will explore further in next two weeks. Ald. Rue Simmons, inquired whether this could affect other houses of worship in community. Ald. Wynne, summarized the substitution of special use process. Ald. Rainey, further described regulations regarding abandonment of a special use. A motion by Ald. Fiske to amend the ordinance failed for lack of a second. Ald. Wilson moved to recommend introduction of Ordinance 13-O-18, seconded by Ald. Rue Simmons. The Committee voted 7-0 to Introduce Ordinance 13-O-18. (P4) Ordinance 14-O-18, Granting a Special Use for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street The Zoning Board of Appeals and City staff recommend adoption of Ordinance 14-O-18 granting special use approval for a Type 2 Restaurant, Rubie’s, at 1723 Simpson Street in the B1 Business District. This recommendation is conditional on the replacement of the building’s glass block windows with unobstructed transparent glass and removal of iron bars on windows and doors. The applicant has complied with all zoning requirements and meets all of the standards for a special use in this district. For Introduction Ald. Wilson moved for introduction, seconded by Ald. Revelle. Jasmine, 5th Ward resident, spoke in support of the vision of the restaurant. Leticia Walker, supports economic development of Rubie’s and feels it is a convenient location for restaurant. Michelle Askew, who grew up in 5th Ward, stated that Rubie’s is welcoming for children’s development and a healthier restaurant option and is in support of help with windows. Antonia Simpson, supports Rubie’s as a mother and educator to provide meals for children. It would give back to community and provide a place for teenagers. Eddie Hatfield, who grew up in the 5th Ward, spoke in support of Rubie’s. Erica Hatfield, spoke in support and inquired whether funding would be available for Rubie’s. 407 of 549 Planning & Development Committee Meeting Page 4 of 10 Minutes of January 22, 2018 Ald. Rainey, stated it is a perfect location for restaurant. Attended ZBA and heard conditions of approval regarding windows/bars needed before special use approved. Ald. Rainey suggested holding until facade improvement grant application received and Economic Development Committee meets. Robert Crayton, applicant for Rubie’s, wants windows/bars removed. Bids have been received today. Doesn’t believe need grant application to move forward. Planning and Zoning Administrator Mangum, stated that DAPR and the ZBA both reviewed and agreed that glass block windows need to be removed and replaced. The ZBA also had condition that grant application should be submitted prior to approvals. Staff believes that improvements for physical improvements need to be made before issuance of business license. Ald. Rue Simmons clearly communicated as has staff that windows/bars need to be removed. The vision of use of space by the applicant has been fluid. The first phase is limited to 10 people including 4-5 staff, the second phase now described as including programming with District 65. Would like to see more details of 2nd phase to determine whether the building may support those uses including an additional bathroom for more than 10 occupants. Mr. Crayton stated that the first phase would be limit to 10 and the second phase would occur once capital has been built. Ald. Rue Simmons requested additional details for the second phase including hours of operation, number of people, if building will work for use. Windows and bars on doors are ward-wide issue, not specific to this building. Mr. Crayton stated that looking to open first phase because now 6-months into lease and losing money. It took longer for bids because no Evanston company doing work regarding block windows. Ald. Rue Simmons noted that work was started early without permit and staff was not allowed into building. Mr. Crayton stated that funding is not currently available for removal of bars and windows and wasn’t part of previous meetings. Ald. Wynne, described Economic Development Committee process for funding facade improvement grants, restated ZBA recommendation, and explained that a special use permit is needed for a Type 2 Restaurant. Mr. Crayton agrees that glass block and bars should be removed and inquired about reason for two phases. 408 of 549 Planning & Development Committee Meeting Page 5 of 10 Minutes of January 22, 2018 Director Leonard, stated that the first phase limited occupancy based on building code requirements for ADA restrooms. A special use is needed for operating the restaurant. Ald. Wilson, stated that requiring funding should not be a part of the special use approval and suggested removing the subsection. Mr. Crayton explained his understanding of the limitations of the number of occupants and need for a special use only for more than 10 persons. Ald. Wynne requested a meeting with City staff to explain more clearly and noted other businesses limited by ADA restroom requirements. Mr. Crayton stated that there was previously restaurant at location. Director Leonard stated that based on staff review it was not operating in previous two years as the reason for new special use. Ald. Rue Simmons noted that staff has been very clear. There was a restaurant previously but has not been operating and used for storage. Ald. Wynne noted abandonment and need to reapply for a special use. Ald. Wilson stated it is a great location for restaurant, but noted that in looking at the space the applicant should consider long-term plans before making restaurant investment. Ald. Wynne concurred about thinking long-term about usage of the space. Monique Parsons stated that she has been helping to navigate process. The ZBA recommendation was for good faith to pursue funding, not to deny business license prior to windows/bars being replaced. This morning, in response to questions about conditions, an email was sent about conditions and if added after meeting should have been communicated following meeting. Noted that storefront application has been submitted electronically with an automatic response generated and that some recommended contractors in Evanston do not perform work proposed. In response to Ald. Wynne’s inquiry, Ms. Parsons stated she doesn’t know when the owner submitted the application. Ald. Wilson motioned to remove condition E, subsection 3-E, as a condition of the Special Use, seconded by Ald. Rue Simmons. Ald. Rainey moved to hold in Committee until next meeting. The item was held in Committee until February 12, 2018. 409 of 549 Planning & Development Committee Meeting Page 6 of 10 Minutes of January 22, 2018 Ald. Wynne stated that staff would meet with applicant to describe process and timeline for special use and grant. Condition regarding window transparency remains in ordinance. (P5) Ordinance 5-O-18, Granting Special Use Permit for a Planned Development Located at 601 Davis Street The Plan Commission and staff recommend denial of Ordinance 5-O-18 for approval of the Planned Development to construct a 33-story, 318-unit residential building with 7,481 square feet of ground floor commercial space (including a drive through for a financial institution, Chase Bank) and 176 on- site parking spaces. The applicant is requesting 8 site development allowances. The proposed development exceeds the maximum site development allowances for building height and FAR, therefore, a super- majority (two-thirds) vote by the City Council is required for approval. On January 8, 2018 Ordinance 5-O-18 was continued until January 22, 2018 for Introduction. For Introduction Dave Cocagne, applicant made a presentation describing the history/timeline of project, existing conditions, and the context of the area. Mr. Cocagne noted that the project was about 60 feet taller because the University Building is preserved and that the pedestrian experience would be improved due to reduction in curb cut width. The number of development allowances are in line with other projects. The public benefits were described, including preserving historic structure, removing incompatible land uses, providing affordable housing per Mayor Tisdahl, and increasing tax revenues. Tina Paden, spoke in opposition, stated that Evanston is losing charm and looking more like Chicago. Hank Goldman, spoke in opposition, the project is too big with too many variances, and doesn’t fit the character. Jack Weiss, spoke in favor. The parcel has been vacant for over 30 years. He expressed concerns but noted development allowances are typical, and that this is one of densest blocks, an appropriate location. The number of dwelling units is similar to others in the dense walkable urban location. Junad Rizki, spoke in opposition, there is no plan for downtown, should be a computer generated model. There is no vision, better architecture is needed, and CIty should not be giving away parking. Mike Breclaw, 1519 Davis, spoke in favor of dense downtown projects that are sustainable, of appropriate density and scale, and provide additional revenue for the city. 410 of 549 Planning & Development Committee Meeting Page 7 of 10 Minutes of January 22, 2018 Prudence Moylan, spoke in favor because the design is an asset to the City and because affordable housing would be within the building. St. Vincent DePaul’s affordable housing work is complementary and not duplicating. Pam Matambanado, of St. Vincent DePaul Society, stated that they run case management, teaching residents how to sustain and to break cycle of poverty. Sue Loellbach, of Joining Forces, noted that inclusionary housing is needed as a tool because of undue exclusionary zoning history and requested to maximize the number of onsite units. Dan Barton, Spice and Tea Exchange owner, spoke in favor for other small business owners, stating that development is good for the City and small businesses. Neil Sheehan, spoke in favor, Evanston’s downtown is distinguished from other communities. High quality new development would energize the block and renovate the University Building. Brad White, spoke in favor, as former Landmarks Illinois Chair the development would reuse the site, preserve the University Building, expand the property tax base, and provide affordable housing. Lin Ewing, spoke in opposition, because of concerns with height, amount of affordable units, density, and diversity. Also, appreciate setback, but not sure taxes will be lowered and not sure of vacancy rate. Chris Body, owner of business property in downtown, spoke in favor for reasons stated by others. Lane Howard, spoke in favor, because the development can help relieve tax pressure and help businesses. Elizabeth Collen, spoke in favor, due to more vibrancy and safety. Jeanine Martin, spoke in favor due to property tax support. Theresa Melroy, spoke in favor, stating it was the right place for development. Clare Kelly, spoke in opposition due to concern with lack of zoning, low public benefits. Spoke of need for lobbying ordinance. Kiera Kelly, spoke in opposition, it is an empty lot, but can do better. There are minimal pub benefits, it does not meet IHO. Noted Crain’s listing of units underway and vacancy rate, stated that DAPR and Plan Commission 411 of 549 Planning & Development Committee Meeting Page 8 of 10 Minutes of January 22, 2018 recommended against. Also, expressed a lack of confidence in process and the need for a development plan and a moratorium on development. Darlene Cannon read a statement in opposition from Dominic Hilare. Chris Kruger, cautioned about funding to religious institution, recruiting of D65 referendum supporters to speak, displacement because of new buildings, income disparity, and spoke for the need for the best deal for residents. Ted Smuckler, representing Open Communities, stated he was neutral regarding high-rises, but there is a need to strengthen IHO and provide more onsite units. Another speaker in opposition, there is too much density and not wanted by residents. Jackie Prince, concerned with increase in trucks and busses and pollution. Ald. Wilson moved to introduce, seconded by Ald. Revelle. Ald. Wilson, stated downtown is a fantastic place and vibrant. The City is mostly built-up and there is interest in developing downtown. The Downtown Plan became obsolete after it was developed. Although there are parameters for exceptions, is not comfortable supporting the project. The City has an extensive review process for development and decisions aren’t rushed. Ald. Fiske, is proud of steps to make downtown more livable and active, believes there is a need for more office space. Appreciates the Hyatt Hotel, an as of right development. Should be looking at future of downtown development, because some proposed developments are not supportable. Although there will be additional development, charm is important in attracting development to Evanston. Is not in support of this proposed development and believes need discussion of future of downtown. Ald. Revelle, stated everyone spent a lot of time on process. There are many positives to redevelop site including economic vitality, reducing drive-through lanes, preserving University Building, supporting homeless families as an important need. However, height and density too far beyond what is appropriate: Height exceeded by almost 100 feet versus development allowance, density 318 dwelling units versus 93 permitted, additional vehicle hazards for pedestrians, and precedent for future development allowances. The fee-in-lieu for Affordable Housing Fund is more comprehensive than proposal from Vermillion. Ald. Wynne, is in agreement with Ald. Revelle and others about downtown improvement, but believes a plan is possible and needed for downtown. Not necessarily the number of variances but the extent: height, density, FAR, a drive-through that will be obsolete in area where it should be eliminated. It 412 of 549 Planning & Development Committee Meeting Page 9 of 10 Minutes of January 22, 2018 would be foolish to use public parking intended to attract retail customers. Real estate taxes are not a public benefit and others proposed are not sufficient. The developer has not listened to DAPR and Plan Commission. Cannot support the project. Ald. Rue Simmons has heard opposition from 5th Ward as a result of Inclusionary Housing. There is a need more onsite units and a project that is closer to the IHO requirements. Ald. Rainey, agrees it is a good looking building and will add to the tax base. A unique approach is being proposed for affordable housing. The variances are extreme, but a project is needed at that location, and suggested tabling for 4 months to evaluate a lower building with different affordable housing. Ald. Rue Simmons would support tabling if possible. Mr. Cocagne stated that he would entertain tabling the item. Ald. Fiske is not in support of tabling and feels that the development should start over, including improving the building design. Ald. Wynne, was not in support of tabling, noting that the developer heard from DAPR and Plan Commission, but did not make changes and should not be rewarded for ignoring the process. Ald. Fiske requested to call the question. Ald. Wynne called the question. Ald. Wilson moved to recommend introduction of Ordinance 5-O-18, seconded by Ald. Revelle. The Committee voted 1-6 and the Ordinance 5-O-18 was not Introduced. IV. ITEMS FOR DISCUSSION (PD1) 1740 Hinman Avenue Building Renovations Staff requests review of the applicable Zoning and Building Code standards for permit review and requests direction from the Planning and Development Committee, which could come in the form of a referral to the Plan Commission if a Zoning Text Amendment is recommended or a recommendation for no further action. For Discussion Ald. Fiske made a referral to the Plan Commission to address partial bedrooms using borrowed light with 5-foot tall walls. 1740 Hinman Ave is a building with 2-bedroom units that are becoming 4-bedroom units. The leases are either not being renewed or rents are increasing. The changes are not consistent with IHO and units are being changed to student housing. Cameel Halim, property owner stated that he was only notified of this item on Friday by the media and is spending millions to upgrade the building. 413 of 549 Planning & Development Committee Meeting Page 10 of 10 Minutes of January 22, 2018 Ald. Wilson stated that any changes would not affect this building. Mr. Halim noted that these are large 1,700 square foot apartments. Ald. Fiske stated it would not affect current units that have building permits. Deputy City Attorney Masoncup stated that the Law Department would review the issue. Mr. Halim stated that tenants are already creating partitions which creates fire hazards. Ald. Wynne seconded the referral. (PD2) Public Benefits for Planned Developments Staff requests direction from the Planning and Development Committee, which could come in the form of a referral to the Plan Commission if a Text Amendment is recommended or a recommendation for no further action. For Discussion The item was held until February 26, 2018. (PD3) Impact Fees from Planned Developments Staff requests direction from the Planning and Development Committee, which could come in the form of a referral to the Plan Commission if a Text Amendment is recommended or a recommendation for no further action. For Discussion The item was held until February 26, 2018. V. COMMUNICATIONS There were no communications. VI. ADJOURNMENT The meeting adjourned at 10:50 p.m. Respectfully submitted, Scott Mangum Planning and Zoning Administrator 414 of 549 For City Council meeting of February 12, 2018 Item P1 Resolution 10-R-18, Granting Municipal Use Exemption for Public Utility (Water Pumping Station) at 2525 Church Street For Action To: Planning and Development Committee From: Erika Storlie, Assistant City Manager Johanna Leonard, Director of Community Development Scott Mangum, Planning and Zoning Administrator Subject: Resolution 10-R-18, Granting Municipal Use Exemption for Public Utility (Water Pump Station) at 2525 Church St. Date: February 7, 2018 Recommended Action Staff and the Design and Project Review Committee (DAPR) recommend approval of Resolution 10-R-18 granting a Municipal Use Exception for the location of a Public Utility at 2525 Church Street in the OS Open Space District, where Public Utilities are neither a permitted or special use. Livability Benefits Built Environment: Enhance public spaces Summary As a result of the City’s agreement to provide water to the communities of Niles and Morton Grove, the proposed Morton Grove – Niles Water Commission Intermediate Pump Station is proposed to be located at the south end of Beck Park, at 2525 Church Street. The City recently entered into a 50-year lease with the property owner, the Metropolitan Water Reclamation District, and allocated funding to demolish the existing structure, the former Shore School Building. Although not proposed as part of this project, the pump station building would support future conceptual plans for an adjacent splash pad park. In addition to the water pump station, the proposed 3,620 square-foot structure would include two public restrooms, a drinking fountain and a utility room where the mechanical equipment for potential splash park could be installed. Memorandum 415 of 549 2 While a Public Utility is not a permitted use within the OS Open Space Zoning District, the Zoning Ordinance (6-7-4) states that any governmental or proprietary function owned or operated by the City shall be a permitted use in any district. The City Council may approve buildings and structures that do not comply with all of the requirements of the underlying district, if they are necessary for the provision of desired City services and if the adverse impact on surrounding properties resulting from such noncompliance is minimized. Adverse impacts may be minimized by design, architectural treatment, screening, landscaping and/or placement on the lot. Such plan for reduction of adverse impact shall be subject to review by the Design and Project Review Committee. The proposed site plan, landscape plan, and building elevations were presented to DAPR on February 7, 2018 and the Municipal Use Exemption and plan to minimize adverse impacts received a unanimous positive recommendation. The water pump station functions will be contained within a building that will be located toward the western (channel) portion of the site, away from residences on the east side of McDaniel Ave. The building will be masonry clad and will contain restrooms, a utility room and drinking fountain amenities for future park users. Attachments Resolution 10-R-18 Aerial Map Zoning Map Street View from Church Street Plat of Survey Site and Landscape Plan Floor Plan Building Elevations, Renderings, and Building Materials 416 of 549 2/7/2018 10-R-18 A RESOLUTION Granting a Municipal Use Exemption for the Construction of a New Water Pump Station Located in the OS Open Space Zoning District at 2525 Church Street WHEREAS, the City of Evanston plans to demolish the existing institutional structure at 2525 Church Street, located in the OS Open Space Zoning District, and construct a new water pump station on the same site; and WHEREAS, Section 6-7-4 of the Zoning Ordinance provides that: Any governmental or proprietary function owned or operated by the City shall be a permitted use in any district. The City Council may approve buildings and structures owned and operated by the City that do not comply with all of the requirements of the underlying district, if they are necessary for the provision of desired City services and if the adverse impact on surrounding properties resulting from such noncompliance is minimized. Adverse impacts may be minimized by design, architectural treatment, screening, landscaping and/or placement on the lot. Such plan for reduction of adverse impact shall be subject to review by the Design and Project Review Committee. and WHEREAS, the Design and Project Review Committee met on February 7, 2018 to review the project, found that the work minimizes the adverse impact of Zoning noncompliance on surrounding properties, and recommends approval of the municipal use exemption to the City Council; and 417 of 549 10-R-18 ~2~ NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS: SECTION 1: The foregoing recitals are found as facts and made a part hereof. SECTION 2: The City Council hereby finds that construction of the Water Pump Station is necessary for the provision of City services, minimizes the adverse impact of zoning noncompliance on surrounding properties, and approves the project. SECTION 3: The City Council, pursuant to Section 6-7-4 of the Zoning Ordinance, grants a Municipal Exception to the Zoning requirements for the OS District, for a City of Evanston Water Pump Station to be constructed at 2525 Church Street. SECTION 4: This Resolution shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. ________________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Adopted: __________________, 2018 Approved as to form: _______________________________ W. Grant Farrar, Corporation Counsel 418 of 549 Aerial Map - 2525 Church Street City of Evanston IL, Imagery courtesy Cook County GIS User drawn points Tax Parcels January 31, 2018 0 0.03 0.060.015 mi 0 0.055 0.110.0275 km 1:2,000 This map is not a plat of survey. This map is provided "as is" without warranties of any kind. See www.cityofevanston.org/mapdisclaimers.html for more information.Copyright 2016 City of Evanston419 of 549 Zoning Map - 2525 Church Street User drawn points Zoning Boundaries & Labels Tax Parcels January 31, 2018 0 0.03 0.060.015 mi 0 0.055 0.110.0275 km 1:2,000 This map is not a plat of survey. This map is provided "as is" without warranties of any kind. See www.cityofevanston.org/mapdisclaimers.html for more information.Copyright 2016 City of Evanston420 of 549 421 of 549 422 of 549 NORTH NOTES:FLOOR RATIOBUILDING AREA/LOT SIZE= 3025 SF/12,230 SF = 0.25AVERAGE GRADESAT PROPERTY LINE ALONG CHURCH ST. EL 599+/-AT PROPERTY LINE ALONG MCDANIEL AVE. EL 595+/-1/30/2018 11:21 PM27793-PKGF-CG02TONY.DWGCOUNTYTOTALSHEETSSHEETNO.CONTRACT NO.FILE NAME =PROJECT MANAGERPLOT SCALEPLOT DATEDESIGNEDCHECKEDCHECKEDDRAWNREVISEDREVISEDREVISEDREVISEDJOB NO.COOK601/31/1827793.01LARRY THOMAS64SCALE: 1"=20'0123AT FULL SIZEINcm01234567827793-PkgF-CG02TONY.dwgMORTON GROVE - NILES WATER COMMISSION 1"=20'A.M. SMURLOL.E. THOMASD. JACKSONL.E. THOMAS MGNWC INTERMEDIATE PUMP STATIONCIVILSITE AND LANDSCAPE PLANCG02WATERMAINSITE BOUNDARYLEGEND:MANHOLECATCH BASINFENCEFORCE MAINGAS MAINDEMOLITIONSILT FENCEEXISTING STORM SEWERPROPOSED STORM SEWEREXISTING SANITARY SEWERPROPOSED SANITARY SEWEREXISTING COMBINED SEWERLIMITS OF RIPARIAN BUFFERLIMITS OF BASE FLOOD19' DRIVE. TIES INTOEXISTING PARKING LOTTRANSFORMERPROPOSED EASEMENTCHURCH STREET5' SIDEWALKPROPERTY LINEMCDANIEL AVE.EXISTING PARKING LOTSAMPLING MANHOLESANITARY PUMPSTATIONEXISTING TREES TO REMAINPART SHADE MED-WETSEED MIXTUREPART SHADE MED-DRYSEED MIXTURE19' DRIVERAIN GARDENA-CG03A-CG03FF EL 602.024" TRANSMISSION MAIN24" TRANSMISSION MAINDIRECTIONAL DRILL PIT423 of 549 0123AT FULL SIZEINcm01234567827793-PkgF-CG02TONY.dwgMORTON GROVE - NILES WATER COMMISSION 1"=20'A.M. SMURLOL.E. THOMASD. JACKSONL.E. THOMAS MGNWC INTERMEDIATE PUMP STATIONCIVILLANDSCAPE DETAILSCG031/30/2018 11:06 PM27793-PKGF-CG02TONY.DWGCOUNTYTOTALSHEETSSHEETNO.CONTRACT NO.FILE NAME =PROJECT MANAGERPLOT SCALEPLOT DATEDESIGNEDCHECKEDCHECKEDDRAWNREVISEDREVISEDREVISEDREVISEDJOB NO.COOK601/31/1827793.01LARRY THOMAS64WATERMAINSITE BOUNDARYLEGEND:MANHOLECATCH BASINFENCEFORCE MAINGAS MAINDEMOLITIONSILT FENCEEXISTING STORM SEWERPROPOSED STORM SEWEREXISTING SANITARY SEWERPROPOSED SANITARY SEWEREXISTING COMBINED SEWERLIMITS OF RIPARIAN BUFFERLIMITS OF BASE FLOODSECTIONA-CG03CG02SCALE: NTS424 of 549 BCF.O.B.E.121F.O.B.1.1F.O.B.2.1F.O.B.3.1F.O.B.C.2F.O.B.A.2F.O.B.A.13A.3B.1B.2C.1B.3A.11.1℄0 4' 8' 12'1FLOOR PLANSCALE: 3/16" = 1'-0"KEYN1/30/2018 5:30 PMPKG F_AE02A.DWGCOUNTYTOTALSHEETSSHEETNO.CONTRACT NO.FILE NAME =PROJECT MANAGERPLOT SCALEPLOT DATEDESIGNEDCHECKEDCHECKEDDRAWNREVISEDREVISEDREVISEDREVISEDJOB NO.COOK341123222793.01pkg F_AE02A.dwgMORTON GROVE - NILES WATER COMMISSIONLARRY THOMAS3/16" = 1'-0"XX/XX/18R. KNAPPR. KNAPPR. RATCLIFFR. KNAPP############MGNWC INTERMEDIATE PUMP STATIONFLOOR PLANAE02A63ENLARGEDCOLUMN DETAILSCALE: 1" = 1'-0"2ENLARGEDCORNER DETAILSCALE: 1" = 1'-0"4ENLARGEDWALL DETAILSCALE: 1" = 1'-0"AHU-2AHU-1624425 of 549 1EAST ELEVATIONSCALE: 1/8" = 1'-0"0 8' 16'3SOUTH ELEVATIONSCALE: 1/8" = 1'-0"0 8' 16'4NORTH ELEVATIONSCALE: 1/8" = 1'-0"0 8' 16'1/30/2018 5:40 PMPKG F_AE04A.DWGCOUNTYTOTALSHEETSSHEETNO.CONTRACT NO.FILE NAME =PROJECT MANAGERPLOT SCALEPLOT DATEDESIGNEDCHECKEDCHECKEDDRAWNREVISEDREVISEDREVISEDREVISEDJOB NO.COOK22793.01pkg F_AE04A.dwgMORTON GROVE - NILES WATER COMMISSIONLARRY THOMAS1/8" = 1'-0"12/04/17R. KNAPPR. KNAPPH. MASCOTER. KNAPPADD.2 12-04-17ADD.4 12-15-17######MGNWC INTERMEDIATE PUMP STATIONELEVATIONS & BUILDING SECTIONSAE0462WEST ELEVATIONSCALE: 1/8" = 1'-0"0 8' 16'62426 of 549 427 of 549 428 of 549 Morton Grove Niles Intermediate Pump Station – Color Selections Face Brick - Belden Brick Company – Sunburst Blend Split Face Block - Echelon – Oak 429 of 549 Roofing – Architectural Bark wood shingle roofing – Gray Cast Stone - Continental Cast Stone – 1102 Natural Stone 430 of 549 Doors & Trim – Pac Clad – Medium Bronze 431 of 549 For City Council meeting of February 12, 2018 Item P2 Ordinance 21-O-18 Application for a Special Use for a Special Educational Institution- Public For Introduction To: Honorable Mayor and Members of the City Council Planning and Development Committee From: Johanna Leonard, Director of Community Development Scott Mangum, Planning and Zoning Administrator Meagan Jones, Neighborhood and Land Use Planner Subject: Ordinance 21-O-18, Granting a Special Use for a Special Educational Institution- Public at 1233-35 Hartrey Avenue Date: January 30, 2018 Recommended Action The Zoning Board of Appeals and City staff recommend adoption of Ordinance 21-O-18 granting special use approval for a Special Educational Institution- Public in the I2 General Industrial Zoning District in order to operate a high-school for students with behavioral and emotional needs. The applicant has complied with all zoning requirements and meets all of the standards for a special use for this district. Livability Benefits Education, Arts & Community: Provide quality education from cradle to career. Economy & Jobs: Expand job opportunities. Summary The applicant proposes to operate a Special Educational Institution- Public for students with behavioral and emotional needs. The school would start with approximately 22 students with the potential to expand to up to 40 students. The school would create 12 new jobs (teachers and staff) with possible expansion to up to 15-18 positions. The School would operate between the hours 8:00 a.m. and 3:00 p.m. with the possibility of expanding hours in the future. There are 6 parking spaces in front of the tenant space that will be designated for the school’s use; this includes 3 visitor parking spaces, 2 drop-off spaces and 1 ADA compliant space. The building owner also owns parking lots on the south side of Dempster Street between Hartrey Avenue and Pitner Avenue which will be used for teacher and staff parking. A school bus will be utilized for some students with special educational needs and two safety officers will be onsite to direct traffic. Memorandum 432 of 549 The interior space includes classrooms, offices, locker area and a multipurpose room. Food will be delivered to the site and not prepared at this location. SITE PLAN: During the DAPR (Design and Project Review) Committee meeting the Committee noted ramps and other entrances would be reviewed in further detail for ADA compliance as part of the building permit process. ETHS intends to add signage to the building. The Committee voted unanimously to recommend approval of the proposed Special Use with conditions related to employee parking, bike parking and improvements to the parking area (including sealcoating, striping and signage). Comprehensive Plan The Evanston Comprehensive General Plan encourages the adaptive reuse of existing structures and vacant, blighted properties. The Comprehensive Plan also calls for recognizing the benefits of mixing residential, commercial and institutional uses in neighborhoods in addition to maintaining the appealing character of Evanston’s neighborhoods while guiding their change. The proposed use could also lend itself to the goal of supporting and encouraging efforts at employment assistance and linkages. The Comprehensive Plan specifically includes: Objective: Maintain the appealing character of Evanston’s neighborhoods while guiding their change. Policy: Encourage creative adaptive reuse of properties available for redevelopment using zoning standards and the Design & Project Review process. 433 of 549 Objective: Recognize the benefits of mixing residential, commercial and institutional uses in neighborhoods. Policy: Promote employment linkages and open communication between neighborhood residents and local employers. Policy: Minimize the adverse effects of such circumstances as traffic and parking congestion or incompatible hours of operation as part of City technical assistance or zoning/site plan review of businesses and institutions proposing expansion or relocation to sites adjacent to residential areas. Objective: Support and encourage efforts at employment assistance and linkages. Policy: Promote linkages between local schools and local employers that help Evanston students become competitive members of the workforce. The proposed educational institution will occupy a currently vacant space within a mixed-use building, improve the aesthetics of that property, and provide an appropriate use for the neighborhood. Legislative History January 23: The ZBA unanimously recommended approval of the special use for a Special Educational Institution- Public at 1233-35 Hartrey, with the following conditions: 1. Hours of operation shall not exceed 6am – 10pm, Monday through Friday. 2. Employees must park in the parking lot on the southwest Corner of Dempster Street and Hartrey Avenue. 3. Applicant agrees to install signage indicating where on-site parking spaces are located on the Subject Property 4. Bicycle parking spaces for twelve bicycles must be located on the Subject Property. 5. There shall not be on-street drop-off of students from passenger vehicles. 6. Applicant agrees to make parking lot improvements including sealcoating and striping. 7. Applicant agrees to install School Zone signage. 8. Substantial compliance with documents and testimony on record. Attachments Proposed Ordinance 21-O-18 January 23, 2018 ZBA Draft Meeting Minutes Excerpt ZBA Findings January 23, 2018 ZBA Packet https://www.cityofevanston.org/home/showdocument?id=35412 434 of 549 1/26/2018 21-O-18 AN ORDINANCE Granting a Special Use Permit for a Special Educational Institution – Public in the I2 General Industrial Zoning District (“Evanston Township High School”) WHEREAS, the Zoning Board of Appeals (“ZBA”) met on January 23, 2018, pursuant to proper notice, to consider case no. 17ZMJV-0109, an application filed by Evanston Township High School (the “Applicant”), lessee of the property legally described in Exhibit A, attached hereto and incorporated herein by reference, commonly known as 1233-35 Hartrey Avenue (the “Subject Property”) and located in the I2 Zoning District, for a Special Use Permit to establish, pursuant to Subsection 6-14-3-3 of the Evanston City Code, 2012, as amended (“the Zoning Ordinance”), a Special Educational Institution - Public, “Evanston Township High School,” on the Subject Property; and WHEREAS, the ZBA, after hearing testimony and receiving other evidence, made a written record and written findings that the application for a Special Use Permit for a Special Educational Institution - Public met the standards for Special Uses in Section 6-3-5 of the Zoning Ordinance and recommended City Council approval thereof; and WHEREAS, at its meeting of February 12, 2018, the Planning and Development Committee of the City Council (“P&D Committee”) considered the ZBA’s record and findings and recommended the City Council accept the ZBA’s recommendation and approve the application in case no. 17ZMJV-0109; and 435 of 549 21-O-18 ~2~ WHEREAS, at its meetings of February 12, 2018 and February 26, 2018, the City Council considered and adopted the respective records, findings, and recommendations of the ZBA and P&D Committee, as amended, NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: The foregoing recitals are found as fact and incorporated herein by reference. SECTION 2: The City Council hereby approves the Special Use Permit for a Special Educational Institution - Public on the Subject Property as applied for in case no. 17ZMJV-0109. SECTION 3: Pursuant to Subsection 6-3-5-12 of the Zoning Ordinance, the City Council hereby imposes the following conditions on the Applicant’s Special Use Permit, violation of any of which shall constitute grounds for penalties or revocation of said Permit pursuant to Subsections 6-3-10-5 and 6-3-10-6 of the Zoning Ordinance: A. Compliance with Applicable Requirements: The Applicant shall develop and use the Subject Property in substantial compliance with: all applicable legislation; the Applicant’s testimony and representations to the ZBA, the P&D Committee, and the City Council; and the approved plans and documents on file in this case. B. Hours of Operation: The Applicant may operate the Special Educational Institution - Public authorized by this ordinance only between the hours of 6:00 a.m. and 10:00 p.m. on any given Monday through Friday. C. Employee Parking: Employees must park offsite in the parking lot on the southwest corner of Dempster Street and Hartrey Avenue during the hours of operation. D. On-Site Parking Space Signage: The Applicant agrees to install signage indicating where the on-site parking spaces are located on the Subject Property. E. Bicycle Parking Spaces: The Applicant agrees to install twelve (12) bicycle parking spaces on the Subject Property. 436 of 549 21-O-18 ~3~ F. Parking Lot: The Applicant agrees to make all parking lot improvements and complete all sealcoating and striping prior to opening. G. School Zone Signage: The Applicant agrees to install School Zone signage. H. Student Drop-Off: The Applicant agrees that there must not be on-street drop- off of students from passenger vehicles. I. Recordation: Before it may operate the Special Use authorized by the terms of this ordinance, the Applicant shall record, at its cost, a certified copy of this ordinance with the Cook County Recorder of Deeds. SECTION 4: When necessary to effectuate the terms, conditions, and purposes of this ordinance, “Applicant” shall be read as “Applicant’s agents, assigns, and successors in interest.” SECTION 5: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. SECTION 6: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 7: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 8: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. 437 of 549 21-O-18 ~4~ Introduced: _________________, 2018 Adopted: ___________________, 2018 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 438 of 549 21-O-18 ~5~ EXHIBIT A LEGAL DESCRIPTION PARCEL 1: THAT PORTION OF THE NORTH ½ OF THE NORTH EAST ¼ OF THE NORTH W EST ¼ OF SECTION 24, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN LYING W EST OF THE RIGHT OF W AY OF THE CHICAGO AND NORTHWESTERN RAILWAY (EXCEPT THE NORTH 33 FEET THEREOF AND EXCEPT THE W EST 33 FEET THEREOF DEDICATED FOR ST) LOTS 1, 2, 3, AND THE NORTH ½ OF LOT 4; LOT 23 (EXCEPT THE SOUTH 7 FEET THEREOF) AND ALL OF LOT 24, TOGETHER WITH THE VACATED ALLEY LYING BETWEEN SAID LOTS 1, 2, 3, AND LOTS 22, 23 AND 24 ALSO VACATED CRAIN ST LYING NORTH OF AND ADJOINING SAID LOTS 1 AND 24 AND ALL OF VACATED GREY AVENUE LYING EAST OF AND ADJOINING SAID LOTS 1,2,3, AND THE NORTH ½ OF LOT 4 AND LYING W ESTERLY OF THE RIGHT OF WAY OF THE CHICAGO AND NORTHWESTERN RAILWAY, ALL IN BLOCK 2 OF GROVER AND PITNER’S ADDITION TO EVANSTON, A SUBDIVISION OF THE SOUTH W EST ¼ OF THE NORTH EAST ¼ OF THE NORTH WEST ¼ OF SECTION 24, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN IN THE CITY OF EVANSTON, IN COOK COUNTY, ILLINOIS PARCEL 2: LOTS 44, 45, 46, 47, AND 48 IN RUTT’S SUBDIVISION OF BLOCK 1 IN PITNER’S AND SON’S THIRD ADDITION TO EVANSTON, BEING A SUBDIVISION OF NORTH W EST ¼ OF THE NORTH WEST ¼ OF SECTION 24, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN COOK COUNTY, ILLINOIS PARCEL 3: LOTS 1, 2, 3, 4, 5, 6, AND 7 IN RUTT’S RESUBDIVISION OF BLOCK 1 IN PITNER AND SON’S THIRD ADDITION TO EVANSTON BEING A SUBDIVISION OF THE NORTH W EST ¼ OF THE NORTH W EST ¼ OF SECTION 24, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN COOK COUNTY, ILLINOIS PARCEL 4: LOTS A, B, C, AND D IN OWNER’S RESUBDIVISION OF LOTS 8, 9, 10, 11, AND 12 IN RUTT’S RESUBDIVISION OF BLOCK 1 IN PITNER AND SONS 3RD ADDITION TO EVANSTON BEING A SUBDIVISION OF THE NORTH W EST ¼ OF THE NORTH W EST ¼ OF SECTION 24, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN COOK COUNTY, ILLINOIS PIN: 10-24-103-001-0000 COMMONLY KNOWN AS: 1233-35 Hartrey Avenue, Evanston, Illinois. 439 of 549 Page 1 of 4 Zoning Board of Appeals DRAFT NOT APPROVED MEETING MINUTES ZONING BOARD OF APPEALS Tuesday, January 23, 2018 7:00 PM Civic Center, 2100 Ridge Avenue, Council Chambers Members Present: Lisa Dziekan, Mary Beth Berns, Myrna Arevalo, Mary McAuley, Kiril Mirintchev, Violetta Cullen Members Absent: Scott Gingold Staff Present: Scott Mangum Presiding Member: Mary Beth Berns Declaration of Quorum With a quorum present, Chair Berns called the meeting to order at 7:00 p.m. New Business 1233-1235 Hartrey Ave. ZBA 17ZMJV-0109 Evanston Township High School submits for a Special Use for a Special Educational Institution- Public in the I2 General Industrial Zoning District in order to operate a high- school for students with behavioral and emotional needs (Zoning Code Section 6-14-3- 3). The Zoning Board of Appeals makes a recommendation to City Council, the determining body for this case. Mr. Mangum read the case into the record. Mary Rodino, CFO for ETHS, explained the proposal:  Students are currently transported out of the district.  The District explored multiple Evanston properties including Shore School, which needed repairs.  22 students will be brought back to the community by locating at 1233-1235 Hartrey, as well as 12-18 full time staff positions.  The layout of the space works well and an architect has been consulted.  The location is 3 blocks from ETHS which will allow students to transition to the main campus for activities. Ms. McAuley asked the applicant to expand on the size of the building and other uses and businesses in the building and area. Ms. Rodino responded:  There is warehouse space contiguous to the proposed school space.  Rimland Services is to the north and is not a concern.  Other uses include Sammic restaurant supply distribution.  There is no manufacturing immediately adjacent to the proposed school space.  A meeting was conducted on January 9, 2018 with Alderman Braithwaite and 6 attendees from the surrounding area. 440 of 549 Page 2 of 4 Zoning Board of Appeals  DAPR Committee had concerns about public parking. There are 120 spaces at Hartrey/Dempster that are only 50% utilized. Staff and visitors will park in off-site lots.  There will not be any outdoor activities. All physical education components will occur indoors. Extra-curricular activities will occur at the main ETHS campus.  Bicycle parking will be added, some students drive, some students walk, and transportation will be provided if necessary – likely with one 14-passenger bus for drop off and one for pick up.  Anticipate 22 students and not more than 40 students.  Some deliveries will be made to the space via the loading dock to the north.  The school will function with a closed campus with no student travel during the day.  Security officers will be present during the day. Ms. Cullen noted there was a truck located at the adjacent business at 1pm when she went by the property. Ms. Rodino responded that the truck is not observed often. Ms. Cullen asked about the myriad of uses at the property, and Mr. Mangum explained text amendments have allowed some additional uses in Industrial Districts over time, some existing businesses are legally nonconforming, and Goldfish Swim School obtained a special use for commercial indoor recreation. Ms. Rodino noted the use of the property has changed over time. There are other uses within the building that are for kids. Mr. Mirintchev inquired about ADA compliance and the parking lot, and Ms. Rodino responded:  There are ramps at the front so the entrance is ADA compliant.  Parking spaces are deep but will not be used for tandem parking.  Safety staff will enforce the parking.  Distance between entrances is compliant and both suites are fully sprinkled to meet the minimum travel distance and separation between the two doors.  Current door to the adjacent space will be infilled.  10 year lease signed.  14-student van will be parked at ETHS, but vans may use the drop-off spaces. Chair Berns asked how the applicant will ensure there are no drop-offs on the west side of the street, and the applicant responded safety staff will be on site directing drop-offs and the bus drop-off on the street with the stop arm out. Chair Berns asked how quickly enrollment will get to 40 students and what the long- term goal of the space is, and the applicant responded:  There will be 22 students to start, and a few will be added each year.  The ultimate goal is to transition kids back to the main campus.  Hope to stay at the site for more than 10 years.  Currently 92 students are served off-campus, which is down from the peak of 130 students. A lot of money is currently spent using other facilities for these students.  Food deliveries will be made by a cargo van once per day from the ETHS kitchen. 441 of 549 Page 3 of 4 Zoning Board of Appeals  Patching and repair of parking lot and curb will be done, exterior doors will be replaced, wall signage is proposed, and signage will be provided for the ETHS parking and three adjacent tenants.  Hours of operation will be 8:15am – 3pm for the Director of Special Education and 8am – 4pm for teachers. Evening events are not currently planned other than occasional open houses. Ms. Dziekan asked if there has been communication with parents about the proposal, and the applicant responded not yet, but anticipate most will be favorable. Darlene Cannon, 1317 Pitner Ave., stated the facility will be used for behavior disorder students and mostly minorities, but the school told the public it will be used for white kids from Highland Park. The process is not fair since property owners were not notified of the text amendment. Betty Ester, 1921 Dewey Ave., explained school zone crime is an issue for the police and citizens. Trisha Connolly, 908 Greenwood St., stated a text amendment should be noticed to residents and the issue should be taken up with the City Manager. Tasha Finely, 1915 Pitner, asked why the students cannot be served at ETHS? Kiera Kelly, 2436 Orrington Ave., stated she has concerns and the case should be re- noticed. Mr. Mangum noted there is no mailed notice requirement for text amendments, but both the text amendment and special use are noticed in the Evanston Review newspaper. The ZBA deliberated: Ms. McAuley explained she understands the community concerns but the use is consistent with other uses in this I2 District. Ms. Dziekan added that she understands the notice concerns, and that students are best served in their own community philosophically, and the applicant addressed concerns that were raised. Mr. Mirintchev stated he is in support of the proposal and is okay with the location as long as ample signage is provided and safety personnel are on the street in the mornings. Ms. Cullen stated she agrees that the location is appropriate since it is near the high school and other child oriented uses, but would prefer more community support. Ms. Arevalo stated she supports the project. Chair Berns noted she agrees with the Board’s comments, and the proposal will being money and kids back into the community. 442 of 549 Page 4 of 4 Zoning Board of Appeals The Standards for Special Use were addressed: 1. Yes 2. Yes 3. Yes 4. Yes 5. Yes 6. Yes 7. Yes 8. Yes 9. Yes Ms. Cullen motioned to recommend approval of the special use with the following conditions: 1. Employees shall park off-site. 2. Signage for parking spaces is required. 3. 12 bicycle parking spaces are required. 4. The parking lot shall be improved including patching, sealcoating and striping. 5. Street drop-off is prohibited. 6. School zone signage shall be added. 7. Hours of operation shall not exceed 6am – 10pm. 8. The project shall be developed in substantial compliance with the documents and testimony on record. The motion was seconded by Ms. McAuley and unanimously approved. Other Business There was no other business. Discussion There was no additional discussion. The meeting adjourned at 8:29pm. 443 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 FF II NN DD II NN GG SS FOR STANDARDS OF SS PP EE CC II AA LL UU SS EE PP EE RR MM II TT SS In the case of After conducting a public hearing on January 23, 2018, the Zoning Board of Appeals makes the following findings of fact, reflected in the audio-visual recording of the hearings, based upon the standards for special uses specified in Section 6-3-5-10 of the Zoning Ordinance: Standard Finding (A) It is one of the special uses specifically listed in the zoning ordinance; ___X__Met _____Not Met Vote 6-0 (B) It is in keeping with purposes and policies of the adopted comprehensive general plan and the zoning ordinance as amended from time to time; ___X___Met _____Not Met Vote 6-0 (C) It will not cause a negative cumulative effect, when its effect is considered in conjunction with the cumulative effect of various special uses of all types on the immediate neighborhood and the effect of the proposed type of special use upon the city as a whole; ___X___Met ____Not Met Vote 6-0 (D) It does not interfere with or diminish the value of property in the neighborhood; ___X___Met ____Not Met Vote 6-0 (E) It can be adequately served by public facilities and services ___X___Met ____Not Met Vote 6-0 Case Number: 17ZMJV-0109 Address or Location: 1233-35 Hartrey Ave. Applicant: Evanston Township High School, Lessee Proposed Special Use: Special Educational Institution- Public in the I2 General Industrial District 444 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 (F) It does not cause undue traffic congestion; ___X___Met ____Not Met Vote 6-0 (G) It preserves significant historical and architectural resources; ______Met _____Not Met NA (H) It preserves significant natural and environmental features; and ______Met _____Not Met NA (I) It complies with all other applicable regulations of the district in which it is located and other applicable ordinances, except to the extent such regulations have been modified through the planned development process or the grant of a variation. ___X___Met _____Not Met Vote 6-0 and based upon these findings, and upon a vote __6__ in favor & __0__ against Recommends to the City Council ____ approval without conditions ____ denial of the proposed special use with conditions: __X_ approval with conditions: 1. Hours of operation shall not exceed 6:00am – 10:00pm on any Monday through Friday. 2. Employees must park offsite in the parking lot on the southwest corner of Dempster Street and Hartrey Avenue during the hours of operation. 3. The Applicant shall install signage indicating where the on-site parking spaces are located on the Subject Property. 4. The Applicant shall install twelve (12) bicycle parking spaces on the Subject Property. 5. The Applicant shall make all parking lot improvements and complete all sealcoating and striping prior to opening. 6. The Applicant shall install School Zone signage. 7. There must not be on-street drop-off of students from passenger vehicles. 8. Substantial compliance with the documents and testimony on record. Attending: Vote: Aye No ___X__ Mary Beth Berns __X__ ____ ___X___ Myrna Arevalo __X__ _ __ _______ Scott Gingold _____ ____ 445 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 ___X___ Violetta Cullen __X__ ____ ___X___ Lisa Dziekan __X__ _ ___ ___X___ Mary McAuley __X__ _ ___ ___X___ Kiril Mirintchev __X___ _ __ 446 of 549 Memorandum To: Mayor and Members of the City Council Planning & Development Committee From: Johanna Leonard, Community Development Director Scott Mangum, Planning and Zoning Administrator Cindy Plante, Economic Development Specialist Subject: Ordinance 14-O-18, Granting a Special Use for a Type 2 Restaurant, Rubie’s, at 1723 Simpson St. Date: January 19, 2017 Recommended Action The Zoning Board of Appeals and City staff recommend adoption of Ordinance 14-O-18 granting special use approval for a Type 2 Restaurant, Rubies, at 1723 Simpson Street in the B1 Business District. This recommendation is conditional on the replacement of the building’s glass block windows with unobstructed transparent glass and removal of iron bars on windows and doors. The applicant has complied with all zoning requirements and meets all of the standards for a special use in this district. Livability Benefits Economy & Jobs: Expand job opportunities Built Environment: Enhance public spaces Summary Staff met with the applicant on February 7, 2018 to obtain additional information requested as part of the Planning and Development Committee meeting discussion on January 26th and as part of the Storefront Modernization Grant application. Staff verified the names of any and all special use applicants and business license applicants as Robert Crayton, NIichelle Askew, and Waqas Qureshi. The applicant also verified that the sole owner of the Subject Property is Waqas Qureshi. Building elevation drawings showing the proposed storefront window and door improvements for the Storefront Modernization Grant application will be provided by the applicant in advance of the next Design and Project Review (DAPR) Committee For City Council meeting of February 12, 2018 Item P3 Ordinance 14-O-18 Application for a Special Use for a Type 2 Restaurant, Rubie’s For Introduction 447 of 549 scheduled for February 21, 2018, where this item will be on the agenda. After review and approval by DAPR, the grant will be scheduled for consideration by the Economic Development Committee. The current executed lease with a minimum of five (5) years remaining from the date of Application or provide evidence that the business has operated in Evanston for over five (5) years as part of the Storefront Modernization Grant application will be provided in advance of February 12 City Council Meeting. The glass window block and bars will be removed upon successful receipt of the storefront modernization grant which will be scheduled at the next available Economic Development Committee Meeting after the 100% funding program is approved at City Council, and after the drawings have been approved at DAPR. February 28th and March 28th are the upcoming meetings. The special use permit is contingent upon the removal of the bars and the replacement of the windows. Clarification of the proposed use and a timeline of the evolution of the business model has been provided and is attached to this memo. Staff knows of no other outstanding items related to this application at this time. Background Applicant seeks approval for operation of a takeout restaurant at 1723 Simpson Street, with a menu consisting of breakfast and lunch items including eggs, deli sandwiches and tacos with coffee, tea, and soft drinks available as beverage options. Proposed hours of operation are from 6am-6pm on weekdays, and from 7am to 4pm on weekends, with 2-3 staff expected. The one-story commercial building at 1723 Simpson includes a kitchen and service counter, two bathrooms, storage, and retail space. The building facade along Simpson Street consists of masonry walls with glass block windows and metal security bars on the front door. In 1999 a Special Use Permit (93-O-99) was approved to authorize zoning variations for a one-story building addition and operation of a Type 2 Restaurant within an existing retail food store establishment. That establishment closed in 2010, and the building was most recently occupied by a convenience store, which was in operation from 2012 until 2017. No grocery or retail use is contemplated for the location as part of the current application. The applicant intends to operate the kitchen and service counter portion for take out service only, with the former retail sales floor remaining empty. No customer seating is to be provided at this time. The applicant's intention is to eventually offer this space for community meetings and events, but he is unable to do so at this time because an additional ADA bathroom would be required under the building code to support occupancy by more than 10 people. Customers and employees are encouraged to walk or bike to the location or take public transportation. Customers that drive will utilize street parking. 448 of 549 Exterior modifications to the building were made a condition of approval, including the removal of bars from the door area and replacement of the glass block windows with transparent glass. Staff is not aware of any objections to the proposal. Comprehensive Plan: The Evanston Comprehensive General Plan encourages the utilization of vacant storefronts along existing commercial corridors that can add sales tax revenue and encourage economic vitality. The Comprehensive Plan specifically includes: Objective: Promote the growth and redevelopment of business, commercial, and industrial areas. Objective: Retain and attract businesses in order to strengthen Evanston’s economic base. Rubie’s will use a currently vacant commercial space to open a locally owned and operated business. Legislative History: January 9: The ZBA recommended approval of the special use for a Type 2 Restaurant, Rubie’s, with the following conditions: 1. The block windows must be removed and replaced with transparent and unobstructed windows without bars. 2. The facade improvement grant application for storefront modifications shall be submitted prior to any approvals. 3. Employees shall not park on the street. 4. Hours of operation shall not exceed 6am-10pm, 7 days a week. 5. Deliveries shall occur via the rear only and not on the street. 6. Substantial compliance with the documents and testimony on record including submittal of a signed Sustainability Plan. Attachments Ordinance 14-O-18 January 9, 2018 ZBA Draft Meeting Minutes Excerpt ZBA Findings Special Use Application Update January 9, 2018 ZBA Packet 449 of 549 1/16/2018 1/29/2018 14-O-18 AN ORDINANCE Granting a Special Use Permit for a Type 2 Restaurant Located at 1723 Simpson Street in the B1 Business District (“Gold Star Enterprises, Corp. dba Rubie’s”) WHEREAS, the Zoning Board of Appeals (“ZBA”) met on January 9, 2018, pursuant to proper notice, to consider case no. 17ZMJV-0103, an application filed by Robert Crayton (the “Applicant”), lessee of the property legally described in Exhibit A, attached hereto and incorporated herein by reference, commonly known as 1723 Simpson Street (the “Subject Property”) and located in the B1 Zoning District, for a Special Use Permit to establish, pursuant to Subsection 6-9-2-3 of the Evanston City Code, 2012, as amended (“the Zoning Ordinance”), a Type 2 Restaurant, “Gold Star Enterprises,” on the Subject Property; and WHEREAS, the ZBA, after hearing testimony and receiving other evidence, made a written record and written findings that the application for a Special Use Permit for a Type 2 Restaurant met the standards for Special Uses in Section 6-3-5 of the Zoning Ordinance and recommended City Council approval thereof; and WHEREAS, at its meetings of January 22, 2018 and February 12, 2018, the Planning and Development Committee of the City Council (“P&D Committee”) considered the ZBA’s record and findings and recommended the City Council accept the ZBA’s recommendation and approve the application in case no. 17ZMJV-0103; and 450 of 549 14-O-18 ~2~ WHEREAS, at its meetings of February 12, 2018 and February 26, 2018, the City Council considered and adopted the respective records, findings, and recommendations of the ZBA and P&D Committee, as amended, NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: The foregoing recitals are found as fact and incorporated herein by reference. SECTION 2: The City Council hereby approves the Special Use Permit for a Type 2 Restaurant on the Subject Property as applied for in case no. 17ZMJV- 0103. SECTION 3: Pursuant to Subsection 6-3-5-12 of the Zoning Ordinance, the City Council hereby imposes the following conditions on the Applicant’s Special Use Permit, violation of any of which shall constitute grounds for penalties or revocation of said Permit pursuant to Subsections 6-3-10-5 and 6-3-10-6 of the Zoning Ordinance: A. Compliance with Applicable Requirements: The Applicant shall develop and use the Subject Property in substantial compliance with: all applicable legislation; the Applicant’s testimony and representations to the ZBA, the P&D Committee, and the City Council; and the approved plans and documents on file in this case, including but not limited to: the Sustainability Practices for Type 2 Restaurants. B. Hours of Operation: The Applicant may operate the Type 2 Restaurant authorized by this ordinance only between the hours of 6:00 a.m. and 10:00 p.m. on any given day. C.Employee Parking: Employees may not utilize street parking surrounding the Subject Property during the hours of operation. D. Window Transparency: The Applicant agrees to remove the block windows and install transparent and unobstructed windows without bars prior to issuance of business license. 451 of 549 14-O-18 ~3~ E. Façade: The Applicant agrees to complete all façade construction prior to receiving its Temporary Certificate of Occupancy from the City of Evanston. F. Deliveries: The Applicant agrees that all deliveries to the Subject Property must occur via the rear and not on the abutting street. G. Recordation: Before it may operate the Special Use authorized by the terms of this ordinance, the Applicant shall record, at its cost, a certified copy of this ordinance with the Cook County Recorder of Deeds. SECTION 4: When necessary to effectuate the terms, conditions, and purposes of this ordinance, “Applicant” shall be read as “Applicant’s agents, assigns, and successors in interest.” SECTION 5: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. SECTION 6: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 7: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 8: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. 452 of 549 14-O-18 ~4~ Introduced: _________________, 2018 Adopted: ___________________, 201 8 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 453 of 549 14-O-18 ~5~ EXHIBIT A LEGAL DESCRIPTION LOT 9 (EXCEPT THE EAST 75 FEET THEREOF) IN BLOCK 8 IN PAYNE’S ADDITION TO EVANSTON, A SUBDIVISION OF THE SOUTHWEST ¼ OF THE SOUTHEAST ¼ OF SECTION 12, TOWNSHIP 41 NORTH, RANGE 13 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN COOK COUNTY, ILLINOIS. PIN: 10-12-420-014-0000 COMMONLY KNOWN AS:1723 Simpson Street, Evanston, Illinois. 454 of 549 Page 1 of 3 Zoning Board of Appeals DRAFT NOT APPROVED MEETING MINUTES ZONING BOARD OF APPEALS Tuesday, January 9, 2018 7:00 PM Civic Center, 2100 Ridge Avenue, Council Chambers Members Present: Lisa Dziekan, Mary Beth Berns, Kiril Mirintchev, Scott Gingold, Violetta Cullen Members Absent: Mary McAuley, Myrna Arevalo Staff Present: Scott Mangum, Melissa Klotz, Mario Treto Presiding Member: Mary Beth Berns Declaration of Quorum With a quorum present, Chair Berns called the meeting to order at 7:10 p.m. Approval of Minutes The minutes from the December 19, 2017 Zoning Board of Appeals meeting were motioned for approval by Ms. Cullen and seconded by Ms. Dziekan. The minutes were approved 5-0. New Business 1723 Simpson St. ZBA 17ZMJV-0103 Robert Crayton, lessee, applies for a special use for a Type 2 Restaurant, dba Gold Star Enterprises, in the B1 Business District (Zoning Code Section 6-9-2-3). The Zoning Board of Appeals makes a recommendation to City Council, the determining body for this case. Mr. Mangum read the case into the record and noted recommended conditions. Applicant Robert Clayton explained the proposal: The building is currently vacant but was previously a grocery store and restaurant. Propose to operate the restaurant only, not the grocery store. Phase 1 of the restaurant will occur first, with no more than 10 people in the building at a time (since there is only one ADA restroom currently). Phase 2 will add a second ADA restroom and then the occupancy will not be limited to 10 people. Applicant does not currently have enough capital to add the second restroom, but plans to begin Phase 2 within 2 years. Both phases include take-out service and counter service. Applicant agrees to comply with the conditions DAPR recommended. Restaurant will serve breakfast and lunch and operate from 7am - 3pm. Maximum of 4-5 staff per shift. May add dinner hours at a later date. 455 of 549 Page 2 of 3 Zoning Board of Appeals Mr. Mangum clarified the building code maximum occupancy of 10 includes staff. The applicant continued:  Garbage pickup will occur via the rear of the property.  Deliveries will come in after school hours so not to conflict with school buses, and will be a small van that will deliver on Simpson St. Chair Berns asked if deliveries could be done on the side street rather than Simpson St . and the applicant responded it is likely deliveries could be done via the rear, and then agreed deliveries will not occur on any street. Chair Berns noted a Sustainability Plan was not submitted by the applicant. Mr. Mangum explained the Plan to the applicant, who agreed to submit it. The applicant continued:  No awnings are proposed.  The property has one on-site parking space in the rear for the operator.  The operator has not run a restaurant previously. The end goal is to use the building as a community gathering place but the restaurant is what will pay the bills. The ZBA entered into deliberations: Mr. Gingold noted the special use does not need to condition Phase 1 vs. Phase 2 because the ADA requirement and building code dictates it. Mr. Gingold also noted the plans are not fully detailed, but overall the proposal sounds good. Mr. Mirintchev agreed. Ms. Cullen stated she likes that the operator is community oriented and the business sounds like a great use for that corner. Chair Berns clarified the applicant agreed that deliveries can occur off-street. Ms. Dziekan noted it is very important that the block windows be changed to clear windows, so there should be a condition that the facade improvement grant be submitted prior to any approval. Ms. Cullen and Mr. Mirintchev agreed. Chair Berns agreed that a community gathering place would be a great thing for the neighborhood and stated her excitement to see Phase 2. The Standards were addressed: 1. Yes 2. Yes 3. Yes 4. Yes 5. Yes 6. Yes 7. Yes 8. Yes 9. Yes 456 of 549 Page 3 of 3 Zoning Board of Appeals Ms. Dziekan motioned to recommend approval, which was seconded by Ms. Cullen and unanimously approved with the following conditions: 1. The block windows must be removed and replaced with transparent and unobstructed windows without bars. 2. The facade improvement grant application for storefront modifications shall be submitted prior to any approvals. 3. Employees shall not park on the street. 4. Hours of operation shall not exceed 6am-10pm, 7 days a week. 5. Deliveries shall occur via the rear only and not on the street. 6. Substantial compliance with the documents and testimony on record including submittal of a signed Sustainability Plan. 457 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 FF II NN DD II NN GG SS FOR STANDARDS OF SS PP EE CC II AA LL UU SS EE PP EE RR MM II TT SS In the case of After conducting a public hearing on January 9, 2017, the Zoning Board of Appeals makes the following findings of fact, reflected in the audio-visual recording of the hearings, based upon the standards for special uses specified in Section 6-3-5-10 of the Zoning Ordinance: Standard Finding (A) It is one of the special uses specifically listed in the zoning ordinance; ___X__Met _____Not Met Vote 5-0 (B) It is in keeping with purposes and policies of the adopted comprehensive general plan and the zoning ordinance as amended from time to time; ___X___Met _____Not Met Vote 5-0 (C) It will not cause a negative cumulative effect, when its effect is considered in conjunction with the cumulative effect of various special uses of all types on the immediate neighborhood and the effect of the proposed type of special use upon the city as a whole; ___X___Met ____Not Met Vote 5-0 (D) It does not interfere with or diminish the value of property in the neighborhood; ___X___Met ____Not Met Vote 5-0 (E) It can be adequately served by public facilities and services ___X___Met ____Not Met Vote 5-0 Case Number: 17ZMJV-0103 Address or Location: 1723 Simpson St. Applicant: Robert Cratyton, Tenant Proposed Special Use: Type 2 Restaurant in the B1 Businesse District 458 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 (F) It does not cause undue traffic congestion; ___X___Met __ __Not Met Vote 5-0 (G) It preserves significant historical and architectural resources; ______Met _____Not Met NA (H) It preserves significant natural and environmental features; and ______Met _____Not Met NA (I) It complies with all other applicable regulations of the district in which it is located and other applicable ordinances, except to the extent such regulations have been modified through the planned development process or the grant of a variation. ___X___Met _____Not Met Vote 5-0 and based upon these findings, and upon a vote __5__ in favor & __0__ against Recommends to the City Council _____ approval without conditions __ __ denial of the proposed special use with conditions: __X__ approval with conditions: 1. The block windows must be removed and replaced with transparent and unobstructed windows without bars. 2. The facade improvement grant application for storefront modifications shall be submitted prior to any approvals. 3. Employees shall not park on the street. 4. Hours of operation shall not exceed 6am-10pm, 7 days a week. 5. Deliveries shall occur via the rear only and not on the street. 6. Substantial compliance with the documents and testimony on record including submittal of a signed Sustainability Plan. Attending: Vote: Aye No ___X__ Mary Beth Berns __X__ ____ _______ Myrna Arevalo _____ _ __ ___X___ Scott Gingold _X___ ____ ___X___ Violetta Cullen _X___ _ __ ___X___ Lisa Dziekan __X___ _ __ 459 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 _______ Mary McAuley _____ _ __ ___X___ Kiril Mirintchev __X__ _ __ 460 of 549 Special Use Application – attachment w/ DAPR Recommendations 6. Proposed Project: Project Summary: Rubies’ is a Type-2 eating establishment focusing on providing good, healthy, nutritional and fast food to the local neighborhood and businesses. In PHASE 1 – Rubies will be a carry-out restaurant, which provides a safe, convenient, and comfortable environment reflective of the community. In PHASE 2 – Within two years of operating Phase 1, and once Rubies has established enough capital, a second ADA restroom will be added. This will allow use of the common space. The open space will permit access for customers to eat-in, and activities that will highlight opportunities for the community to engage, learn and celebrate. Rubies will offer a breakfast and a lunch menu, including salads, fresh cold cuts, drinks and take-out prepared dishes. Breakfast will include the following items:  Eggs  chicken breast  bacon  turkey bacon  sausage  ham  Hot and cold cereal (Grits and Oatmeal)  Hash browns  Toast/Muffins  Pancakes  Waffles  French Toast The lunch menu will consist of various cold cut sandwiches (turkey, ham, chicken, beef, etc.) plus prepared salads including:  Caesar Salad  Garden Salad  Potato Salad 461 of 549 In addition, to compliment the breakfast and lunch offerings, the following will be provided:  Tacos w/fixings  Salad Dressings  Chips and Salsa  Sweet Potato Fries  Chips  Fruit  Smoothies  Water/Coffee/Tea/Juice/Soft Drinks DELIVERIES  Regularly scheduled deliveries will be arranged during times not to interfere with school bus arrivals or departures.  Delivery arrivals will be made in vehicles determined by the delivery company, preferably by a cargo or sprinter vans.  Deliveries will be made through the front door or through the side door off Darrow St. GARBAGE PICK-UP  Garbage pick-up will include recycling. BLOCK WINDOWS  The property owner, Ray W. Qureshi submitted an application for the Storefront Modernization Grant application. The applicant will work with the city to determine final bid decision and timeframe for the removal of glass block windows and replacement of doors. SERVICE PLAN:  Relatively inexpensive menu  $6.00 -$10.00/average per meal  4 staff - 2 full-time and 2 part-time  Hours: 6:00am- 6pm weekdays; 7am-4:00pm weekends  Intimate, neighborly atmosphere  For families, neighborhood and community.  Employees will be encouraged to take public transportation, walk or bike to work. 462 of 549 To: Honorable Mayor and Members of the City Council Planning and Development Committee From: Johanna Leonard, Director of Community Development Scott Mangum, Planning & Zoning Administrator Melissa Klotz, Zoning Planner Subject: Ordinance 13-O-18, Granting a Special Use for the Expansion of a Religious Institution and Major Zoning Relief for a Third Story Addition at 2014 Orrington Ave. Date: January 12, 2018 Recommended Action The Zoning Board of Appeals and City staff recommend adoption of Ordinance 13-O-18 granting special use approval for the expansion of a Religious Institution, Lubavitch Chabad of Evanston, Inc., and major zoning relief for a third story addition, in the R1 Single Family Residential District. The applicant has complied with all zoning requirements and meets all of the standards for special use and major variations for this district. This Ordinance was approved for Introduction at the January 22, 2018 City Council meeting. Livability Benefits Education, Arts & Community: Support social and cultural diversity Equity & Empowerment: Ensure equitable access to community assets Summary Background History: 2014 Orrington Ave. has existed as a Religious Institution, Lubavitch Chabad of Evanston, Inc., for many years. The City Council denied a request for a special use permit in 1978, however, a trial court found that the City’s denial constituted an impediment to the free exercise of religion as guaranteed by the 1st Amendment of the United States Constitution. The Illinois Appellate Court affirmed the decision and the U.S. Supreme Court denied cert (review) of the Illinois Appellate Court decision (attached). The facility has since operated subject to Ord. 94-O-78 and the eight conditions listed within the ordinance. Memorandum For City Council meeting of January 22, 2018 Item P4 Ordinance 13-O-18, Special Use for Expansion of a Religious Institution and Major Zoning Relief at 2014 Orrington Ave. For Action 463 of 549 Proposal: The property serves the Lubavitch Chabad synagogue community as well as students, faculty, and staff of Northwestern University. The facility offers daily services, Sabbath and holiday services, Shabbat and holiday meals, fellowship, Hebrew school for 5-7 year olds, and other social activities and holiday celebrations. The applicant specifically notes there will be no difference in the frequency, duration, or intensity of use at the property due to the proposed addition and façade modification. The applicant proposes to construct a third-story addition, elevator and overrun shaft, rear balcony, ramp, and new front façade to the two-story synagogue. The existing structure does not meet the operational needs of the facility, most notably that there is only one large shared space within the facility, which makes scheduling of activities and moving of furniture problematic. The proposal adds a second multi-purpose space as well as classrooms and offices to alleviate scheduling conflicts. The proposal also adds an elevator that will bring the facility into ADA compliance. Existing (below) and Proposed (right): The existing building is located in the Northeast Historic District, but is not a contributing structure. The property is surrounded by historic single-family homes as well as other religious institutions that feature residential building characteristics. The applicant has worked extensively with staff and provided at least 10 re-designs over the last 11 months based on meetings with neighbors and staff and Preservation Commission comments to ensure the proposal is adequately compatible to the neighborhood. The Preservation Commission approved a Certificate of Appropriateness for the addition November 14, 2017. The existing structure features legally-nonconforming interior side yard and front yard setbacks. The applicant proposes the following zoning relief: 464 of 549 Required Existing Proposed Building Height Maximum 2.5 stories or 35’ to peak; whichever is less 2-stories 3-stories & 35’ to the peak Knee-Wall Maximum 3’ exterior knee- wall above second story NA ~7.2’ exterior knee-wall North Interior Side Yard Setback 15’ for non-residential structures 5.4’ 5.4’ (NW corner and extending up) South Interior Side Yard Setback 15’ for non-residential structures 9.5’ 9.5’ (extending up) Front Yard Setback 34’ (block average) 27.3’ 27.3’ (extending up) Front Yard Porch Eave Setback 27.5’ (block average) NA 24.8’ The proposed addition does not extend beyond the maximum allowed peak height of 35’. However, the addition features an exterior knee-wall greater than 3’, which is intended to limit bulk above the first two floors to a half-story, or attic-style story. The applicant attempted to design the addition with a 3’ knee-wall to comply with building height, but found it impossible to gain the proper ceiling height in a large enough floor area to meet the facility’s needs. The addition features an exterior knee-wall of approximately 7.2’, for a peak height of 35’. The elevator overrun extends beyond 35’ but is not counted in the building height per the Zoning Ordinance definition. The existing structure features a 5.4’ north interior side yard setback and a 9.5’ south interior side yard setback. A 5’ interior side yard setback is required for principal structure residential uses in the R1 District, which the structure does comply with. However, since the structure is non-residential, 15’ required setbacks apply. Since the property is 40’ wide, the buildable area of the property is only 10’ in width, thus making it difficult to construct a compliant addition. The proposal includes a small increase to the building footprint due to a new enclosed stairwell in the northwest corner of the building. The stairwell will align with the existing building setbacks, taking the location of a rear porch that will be demolished. The proposal also includes a new rear balcony that is located at the southwest corner of the building that is within the south interior side yard setback but again aligns with the existing nonconforming setback. The property features a 34’ required front yard setback based on the block average. Since the second floor of the structure features habitable all-season space above the first floor porch, the principal structure setback is legally nonconforming with a 27.3’ 465 of 549 front yard setback (the same as the porch). Although the habitable space of the structure will not extend closer to the front property line, the area is extending up and therefore increasing the degree of nonconformity so that zoning relief is necessary for the expansion. Within the required front setback, the building is extending up with a new roofline and dormer over the porch for the second floor; there is no third floor proposed within the required front yard setback. Additionally, the applicant proposes an eave off of the front porch that is no more than 30” deep, for a front porch eave setback of 24.8’. The required front porch eave setback is 27.5’. Since the principal structure exists at 27.3’, zoning relief is necessary for a front porch eave. Previous versions of the proposal did not include a front porch eave. However, the eave was added to make the front façade more compatible with the surrounding single family homes, which was encouraged by the Preservation Commission. The eave is not structurally necessary, but the aesthetic improvement it provides is a public benefit since improved curb appeal will benefit the neighborhood. The new third floor will feature composite wood siding that will be minimally visible from grade. The rear stairwell addition features aluminum windows and stucco. The new front façade features aluminum windows and a small amount of composite wood siding. The original brick on the structure will remain. The proposal is an improvement to a longstanding institutional structure that is in need of rehabilitation and expansion to fit the programing needs of the facility. The proposal also greatly improves the aesthetics of the structure by providing a new façade that is compatible with the Northeast Historic District and surrounding neighborhood. City staff has been aware of opposition to this case as it proceeded through two neighborhood meetings and the Preservation Commission, and underwent significant redesign based on comments provided. Since the Preservation Commission approval of the most recent design on November 14, 2017, and public notice of the request for zoning relief, staff has not received any letters of objection to the proposal, though a list of proposed conditions was submitted prior to the DAPR meeting (attached). Several neighbors presented a suggested list of conditions of approval based on the conditions listed in the original 1978 Special Use Ordinance to DAPR and ZBA meetings which is attached. The applicant was in general agreement with the proposed conditions, with the exception of retaining one of the original conditions allowing the ability for one family to live on premises. The recommendation of the Zoning Board of Appeals, contained in Ordinance 13-O-18, is to further revise the amended conditions proposed by neighbors to not prevent the transfer of ownership and to exclude only uses other than the religious institution that would require a special use, but not uses that are accessory to a religious institution which include a school, daycare, or dwelling. If a new organization were to propose operations that were different than what was authorized through the proposed Special Use, that organization would be required to apply for either a Substitution for an Existing Special Use or for a new Special Use. The former requires review by the Zoning Administrator with notice provided in the form of a sign on site and mailings to owners within a 500-foot radius. The decision of the Zoning Administrator of whether the use is similar in nature and intensity to the existing special use and presents no differing or additional impact, or that the use is substantially different in nature, intensity and impact from the existing special use could be appealed 466 of 549 to the Zoning Board of Appeals. If a new Special Use was required it would require approval of the City Council following a recommendation from the ZBA. In order for another use to be considered accessory to a religious institution, and not a separate special use, it would need to be a) subordinate to and serve a principal use; b) subordinate in area, extent, and purpose to the principal use served; c) contribute to the comfort, convenience, or necessity of the occupants, business, or industry of the principal use served; and d) is located on the same lot as the principal use served, except as otherwise expressly authorized by the provisions of the Zoning Ordinance. Per Section 6-4-6-2-H, child daycare centers shall be considered accessory uses in churches whether or not they are operated by the church in which they are located. Comprehensive Plan Some objectives from the Evanston Comprehensive General Plan that apply to this application include: Objective: Maintain the appealing character of Evanston’s neighborhoods while guiding their change. Objective: Recognize the benefits of mixing residential, commercial, and institutional uses in neighborhoods. The proposed addition will improve the functionality of an existing facility while also improving the architectural appeal of the existing structure. Legislative History January 9, 2018: The ZBA unanimously recommended approval of the special use and major zoning relief with the following conditions: 1. Use of the premises shall be limited to a maximum of 30 persons or a lesser number if required by fire, safety or building restrictions. 2. Use of the premises shall be limited to religious services and related study and discussion groups and similar type activities. 3. Use of the premises outside of the uses permitted for a Religious Institution, will exclude other special uses described in Evanston Zoning Ordinance Section 6-8- 2-4 including use as a bed and breakfast establishment, cemetery, child residential care home, daycare center, planned development, public utility, residential care home or a transitional treatment facility. 4. The building shall be soundproofed, or activities within it limited so that sound generated within the building cannot be heard at the property line of the adjoining lots. 5. All of the off-street parking spaces required to serve the actual uses of the building shall be supplied. 6. No persons shall eat or sleep on the premises, except for one person, his or her spouse, their offspring and legally adopted children; provided however, that the foregoing restrictions shall not apply to food served in connection with religious services and provided, further, that up to 4 religious observants may sleep on the premises on the night of the Jewish Sabbath and the Jewish holidays. 467 of 549 7. Lubavitch Chabad of Evanston, Inc. agrees that during its occupancy of the premises it will not operate or avail itself of a van or truck in connection with its occupancy or ownership of the premises. 8. That a covenant in recordable form be executed and delivered to the City of Evanston by the applicant reciting agreement to such conditions. 9. Substantial compliance with the documents and testimony on record. November 14, 2017: The applicant proposed a revised plan to the Preservation Commission that incorporated previous design comments and reduced the fenestration on the second floor front elevation as requested. Commissioners found the revisions were compatible with the surrounding residential neighborhood. Action: Certificate of Appropriateness approved, 7-1. Zoning variations recommended for approval, 7-1. October 17, 2017: The applicant proposed a revised plan to the Preservation Commission that incorporated previous design comments. Commissioners still felt the front elevation was not compatible with the rest of the neighborhood, specifically noting the size of the windows on the second floor front elevation were out of scale compared to the first floor front elevation. August 29, 2017: Preservation Commissioners felt the front elevation was not compatible with the rest of the neighborhood and suggested the applicant continue to revise/simplify the design. Attachments Proposed Ordinance 13-O-18 January 9, 2018 ZBA Draft Meeting Minutes Excerpt Neighbors’ Letter to ZBA regarding Special Use Conditions Preservation Commission Meeting Minutes Excerpts – August 29, 2017, October 17, 2017, and November 14, 2017 ZBA Findings for Special Use ZBA Findings for Major Variations January 9, 2018 ZBA Packet 468 of 549 1/25/2018 1/10/2018 13-O-18 AN ORDINANCE Granting a Special Use Permit and Major Variations for the Expansion of a Religious Institution at 2014 Orrington Avenue in the R1 Single Family Residential District (“Lubavitch Chabad of Evanston, Inc.”) WHEREAS, the Zoning Board of Appeals (“ZBA”) met on January 9, 2018, pursuant to proper notice, to consider case no. 17ZMJV-0018, an application filed by Rabbi Dov Hillel Klein (the “Applicant”), owner of the property legally described in Exhibit A, attached hereto and incorporated herein by reference, commonly known as 2014 Orrington Avenue (the “Subject Property”) and located in the R1 Single Family Residential Zoning District, for a Special Use Permit and Major Variations to establish, pursuant to Subsection 6-8-2-4 of the Evanston City Code, 2012, as amended (“the Zoning Ordinance”), a Religious Institution with a Third Floor, “Lubavitch Chabad of Evanston, Inc.,” on the Subject Property; and WHEREAS, the Applicant requests the following Major Variations: (A) The Applicant requests an addition of a third story with a thirty five (35) foot peak height and exterior knee-wall above three (3) feet where only two and a half (2½) stories with a peak height of thirty-five (35) feet and a maximum of three (3) feet of exterior knee-wall are permitted; (B) The Applicant requests a five and fourth tenths (5.4) of a foot north interior side yard setback and nine and a half (9.5) foot south interior side yard setback where fifteen (15) foot interior side yard setbacks are required for a non-residential structure; and 469 of 549 13-O-18 ~2~ (C) The Applicant requests a twenty-seven and three-tenths (27.3) foot front yard setback where thirty four (34) feet are required; and (D) The Applicant request a twenty-four and eight tenths (24.8) foot front yard porch eave setback where a twenty-seven and six tenths (27.6) foot front yard porch eave setback is required; and WHEREAS, the ZBA, after hearing testimony and receiving other evidence, made a written record and written findings that the application for a Special Use Permit for a Religious Institution and Major Variations met the standards for Special Uses in Sections 6-3-5-10 and 6-3-8-12 of the Zoning Ordinance and recommended City Council approval thereof; and WHEREAS, at its meeting of January 22, 2018, the Planning and Development Committee of the City Council (“P&D Committee”) considered the ZBA’s record and findings and recommended the City Council accept the ZBA’s recommendation and approve the application in case no. 17ZMJV-0018; and WHEREAS, at its meetings of January 22, 2018 and February 12, 2018, the City Council considered and adopted the respective records, findings, and recommendations of the ZBA and P&D Committee and addresses the compelling governmental interest to recognize the agreement made by and between the Applicant and the neighborhood, as amended, NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF EVANSTON, COOK COUNTY, ILLINOIS, THAT: SECTION 1: The foregoing recitals are found as fact and incorporated herein by reference. 470 of 549 13-O-18 ~3~ SECTION 2: The City Council hereby adopts the P&D Committee’s records, findings, and recommendations, and hereby approves, pursuant to Subsection 6-3-8-10(D) of the Zoning Ordinance, the Special Use Permit for a Religious Institution and the Major Variations on the Subject Property as applied for in case no. 17ZMJV- 0018. SECTION 3: The Major Variation approved hereby is as follows: (A) Approval to permit a third story with a thirty-five (35) foot peak height and exterior knee-wall above three (3) feet on the Subject Property. Subsections 6-8-2-9(A) and 6-18-3 permit a maximum two and a half (2.5) stories with a peak height of thirty-five (35) feet and a maximum three (3) foot exterior knee-wall on the Subject Property. (B) Approval to permit a five and fourth tenths (5.4) of a foot north interior side yard setback and nine and a half (9.5) foot south interior side yard setback on the Subject Property. Subsection 6-8-5-8(B)(3) permit a fifteen (15) foot interior side yard setbacks are required for a non-residential structure on the Subject Property. (C) Approval to permit a twenty-seven and three-tenths (27.3) foot front yard setback on the Subject Property. Subsection 6-4-1-9(A)(3) requires a thirty four (34) foot front yard setback on the Subject Property. (D) Approval to permit a twenty-four and eight tenths (24.8) foot front yard porch eave setback on the Subject Property. Subsection 6-4-1-9(B) requires a twenty- seven and six tenths (27.6) foot front yard porch eave setback on the Subject Property. SECTION 4: Pursuant to Subsections 6-3-5-12 and 6-3-8-14 of the Zoning Ordinance, the City Council hereby imposes the following conditions on the Applicant’s Special Use Permit and Major Variations, violation of any of which shall constitute grounds for penalties or revocation of said Permit pursuant to Subsections 6- 3-10-5 and 6-3-10-6 of the Zoning Ordinance: (A) Compliance with Applicable Requirements: The Applicant shall develop and use the Subject Property in substantial compliance with: all applicable legislation; the Applicant’s testimony and representations to the ZBA, the P&D Committee, and the City Council; and the approved plans and documents on file in this case. 471 of 549 13-O-18 ~4~ (B) Occupancy: The use of the Subject Property shall be limited to a maximum of thirty (30) persons or less, in accordance with all applicable fire, safety, and building regulations and restrictions. (C) Use of the Subject Property: The use of the Subject Property shall be limited to religious services, related study, discussion groups, and additional similar activities (D) Excluded Uses on the Subject Property: The use of the Subject Property (not to include the uses permitted for a Religious Institution) excludes all other special uses described in the City Code Section 6-8-2-4, including the following uses: bed and breakfast establishment, child residential care home, daycare center, planned development, public utility, residential care home, or a transitional treatment facility. (E) Soundproofing: The building on the Subject Property must be soundproofed, or activities within it limited so that the sound generated within the building cannot be heard at the property line of the adjoining lots. (F) Parking: The Applicant agrees to supply all of the off-street parking spaces required to serve the actual use of the building. (G) Deliveries: All deliveries shall occur only between 7:00 a.m. and 10:00 p.m. on any given day. (H) Lodging: No person shall sleep on the Subject Property, except for one person, his or her spouse, and children; provided, however, that up to four (4) religious observants may sleep on the premises on the night of the jewish Sabbath and the Jewish holidays. (I) Vehicular Use: The Applicant agrees that during its occupancy of the premises it will not operate or avail itself of a van or truck in connection with its occupancy or ownership of the Subject Property. (J) Recordation: Before it may operate the Special Use authorized by the terms of this ordinance, the Applicant shall record, at its cost, a certified copy of this ordinance with the Cook County Recorder of Deeds. SECTION 5: When necessary to effectuate the terms, conditions, and purposes of this ordinance, “Applicant” shall be read as “Applicant’s agents, assigns, and successors in interest.” 472 of 549 13-O-18 ~5~ SECTION 6: This ordinance shall be in full force and effect from and after its passage, approval, and publication in the manner provided by law. SECTION 7: The special use authorized by this ordinance is specific to the Lubavitch Chabad House of Evanston, Inc. This special use does not run with the land; it must run with the owner and terminates when the ownership of the Subject Property is no longer vested with the Lubavitch Chabad House of Evanston, Inc. This covenant has no precedential value on the treatment of other special use applications in the City and is limited to this specific special use application, which is fully acknowledged and agreed to by the Applicant. SECTION 8: All ordinances or parts of ordinances in conflict herewith are hereby repealed. SECTION 9: If any provision of this ordinance or application thereof to any person or circumstance is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this ordinance is severable. SECTION 10: The findings and recitals contained herein are declared to be prima facie evidence of the law of the City and shall be received in evidence as provided by the Illinois Compiled Statutes and the courts of the State of Illinois. 473 of 549 13-O-18 ~6~ Introduced: _________________, 2018 Adopted: ___________________, 201 8 Approved: __________________________, 2018 _______________________________ Stephen H. Hagerty, Mayor Attest: _______________________________ Devon Reid, City Clerk Approved as to form: ______________________________ W. Grant Farrar, Corporation Counsel 474 of 549 13-O-18 ~7~ EXHIBIT A LEGAL DESCRIPTION THE SOUTH 1/2 OF LOT 5 IN BLOCK 4 IN EVANSTON, IN THE NORTHWEST 1/4 OF SECTION 18, TOWNSHIP 41 NORTH, RANGE 14, EAST OF THE THIRD PRINCIPAL MERIDIAN, IN COOK COUNTY, ILLINOIS. PIN: 11-18-105-030-0000 COMMONLY KNOWN AS: 2014 Orrington Avenue, Evanston, Illinois. 475 of 549 13-O-18 ~8~ EXHIBIT B GENERAL SITE PLAN 476 of 549 EXIST. PORCH AND BALCONY TO BE CONVERTED INTO STAIRCASEEXIST. 2 STORY BUILDING + NEW FLOOR ADDITIONNEW ELEVATOR SHAFTOPEN PORCH ON 1ST FLOOR, EXISTING 2ND FLOOR AND NEW ATTICNEW ADA RAMP4' - 7"3' - 10 1/2"TO BE DEMOLISHED5' - 5 1/2"27' - 3"15' CONCRETE PAVEMENT10' - 0"10' - 0"USED AS ALLEYEXISTING ASPHALT PARKINGEXISTING FENCE3' - 0"2ND FLOOR NEW BALCONYPROPERTY LINELOT 5221.39'221.39'40.15'40.12'ZONING CALCULATIONS1. ZONING DISTRICT -R-1; EXIST. USE -PLACE OF WORSHIP; NEW USE -PLACE OF WORSHIP2. LOT AREA -8885.33 SQ. F. > 7000 SQ. F. PER ZONING CODE3. EXISTING BUILDING FOOTPRINT = 2319.21 SQ. F. 4. NEW BUILDING FOOTPRINT =2319.21 SQ. F.5. EXISTING BUILDING HEIGHT -2 STORIES/25'-0"6. NEW BUILDING HEIGHT -3 STORIES/35'-0" 7.PARKING -EXISTING CONDITION -ASPHALT PARKING IN REAR YARD-NEW CONDITIONS -NO CHANGE1" = 20'-0"1SITE PLAN477 of 549 2BIRD'S EYE ISOMETRIC1SOUTHEAST PERSPECTIVE478 of 549 Page 1 of 4 Zoning Board of Appeals DRAFT NOT APPROVED MEETING MINUTES EXCERPT ZONING BOARD OF APPEALS Tuesday, January 9, 2018 7:00 PM Civic Center, 2100 Ridge Avenue, Council Chambers Members Present: Lisa Dziekan, Mary Beth Berns, Kiril Mirintchev, Scott Gingold, Violetta Cullen Members Absent: Mary McAuley, Myrna Arevalo Staff Present: Scott Mangum, Melissa Klotz, Mario Treto Presiding Member: Mary Beth Berns Declaration of Quorum With a quorum present, Chair Berns called the meeting to order at 7:10 p.m. Approval of Minutes The minutes from the December 19, 2017 Zoning Board of Appeals meeting were motioned for approval by Ms. Cullen and seconded by Ms. Dziekan. The minutes were approved 5-0. New Business 2014 Orrington Ave. ZBA 17ZMJV-0018 Rabbi Dov Hillel Klein, property owner, applies for a special use permit for the expansion of a Religious Institution, Lubavitch Chabad of Evanston, LLC, in the R1 Single Family Residential District (Zoning Code Section 6-8-2-4). The applicant also requests major zoning relief for an addition including a third story with a 35’ peak height and exterior knee-wall above 3’ where 2.5 stories with a peak height of 35’ and a maximum 3’ exterior knee-wall are permitted (Zoning Code Sections 6-8-2-9-A & 6-18- 3), a 5.4’ north interior side yard setback and 9.5’ south interior side yard setback where 15’ is required for a non-residential structure (Zoning Code Section 6-8-2-8-B-3), a 27.3’ front yard setback where 34’ is required (Zoning Code Section 6 -4-1-9-A-3), and a 24.8’ front yard porch eave setback where 27.6’ is required (Zoning Code Section 6 -4-1-9- B). The Zoning Board of Appeals makes a recommendation to City Council, the determining body for this case. Mr. Mirintchev noted he is the architect of record for the case and therefore recused himself. Ms. Klotz read the case into the record. Rabbi Klein, applicant, explained the proposal:  Approximately 40 years ago a special use was recommended by the ZBA for approval but was denied by City Council. The special use was approved via a court case. 479 of 549 Page 2 of 4 Zoning Board of Appeals  The facility provides Hebrew club, interfaith programs, religious services, special holiday celebrations and meals, etc.  The facility is not currently ADA compliant with egress and bathrooms.  Currently there is a winding staircase egress from the second floor, which would not be a safe exit in the case of a fire.  The facility does not currently have meeting rooms, classrooms, etc. and needs more space to add those. The capacity/impact of the use will not increase – instead operations will not have to share or shuffle spaces.  A rear addition was proposed years ago but it was never constructed.  The front façade has been re-designed 7 times throughout this process, and the front of the second story has been reduced in bulk to closer match the neighborhood.  The existing building is closer to the front property line than the requirement, so any change requires variation.  No one lives in the building currently, but previously Rabbi Klein lived there and there may be an emergency that necessitates someone to live there. The applicant would like to keep the option for the future, though the building design does not specifically include a dwelling unit buildout.  Okay with the condition of the 30 person limitation as listed in the original special use.  Neighbors and the applicant have agreed to a list of conditions that are appropriate. Chair Berns asked what the hardship of the property is, rather than the hardship of the use or structure, and Mr. Mirintchev responded the institutional use is the largest hardship since the building was originally constructed as a single family home. Chair Berns asked what the hardship is to exceed the 3’ knee -wall, and Mr. Mirintchev explained it is necessary to gain more space, but the third floor is barely visible because the existing parapet wall is 3’ tall and blocks much of it from view. Ms. Klotz clarified the very first plan submitted included dormers rather than a third story, but the design did not meet the Zoning Ordinance definition of a dormer because the space was bigger than just an addition to accommodate a window opening, so t he 3’ knee wall limitation was then applicable and the addition was considered a third story. A third story just comprised of dormers as defined by the Zoning Ordinance would not provide enough head roof for the use. Mr. Mirintchev further explained how the impact/capacity of the facility will not increase with the added space, and explained how the current operations require the constant moving of things to use the same rooms for multiple uses. Chair Berns asked if the height beyond the 3’ knee-wall is needed to make the minimum headroom in the rear interior stair, which is needed for egress, and Mr. Mirintchev said yes, the stairwell needs the full third story to accommodate a 7’2” headroom. Dave Schoenfeld, neighbor, explained that conditions agreed to by the neighbors are important, especially the limitation of uses added in since the 1978 ordinance. Member Gingold noted those uses would require special use approval anyway. 480 of 549 Page 3 of 4 Zoning Board of Appeals Rabbi Klein summarized that he believes the neighbors like the current proposal, which is less bulky than the original dormer proposal. The ZBA entered into deliberations: Member Gingold noted he supports the project and feels it meets the Standards, but is unsure if legally a special use can be conditioned on the operator rather than the land. Ms. Cullen stated it is unlikely the property will ever revert back to a residential use. Member Gingold noted there is a large cost to this project and the applicant intends to stay at the property indefinitely. Ms. Dziekan commended the applicant for working so closely with the neighborhood and considering a variety of designs. The proposal does keep the residential feel of the neighborhood. Chair Berns noted she does not see a hardship for the property - the hardship is due to the use. She explained she would have preferred to see a proposal with compliant dormers to see if that option would work. However, due to egress code requirements, the third floor with the larger knee-wall is needed. Attorney Treto clarified the special use can limit the use to a religious institution, but cannot be conditioned to limit the current operation only to distinguish between different religious institutions. Any different type of use would need a different special use. Ms. Klotz clarified any other religious institution would need either a Substitution of Special Use or new Special Use if there are any operational differences, and explained the Substitution of Special Use process, neighbor notification, and appeal process. The Standards for Special Use were addressed: 1. Yes 2. Yes 3. Yes 4. Yes 5. Yes 6. Yes 7. Yes 8. Yes 9. Yes Mr. Gingold motioned to recommend approval of the special use, which was seconded by Ms. Cullen and unanimously approved with the following conditions: 1. Adopt list of 9 conditions agreed to by applicant/neighbors with amendments as marked on Exhibit A that clarifies #3 and strikes #8. The Standards for Variation were addressed: 1. Yes 2. Yes 481 of 549 Page 4 of 4 Zoning Board of Appeals 3. Yes 4. Yes 5. Yes 6. Yes 7. Yes Mr. Gingold motioned to recommend approval of the variations, which was seconded by Ms. Cullen and unanimously approved with the condition the project is within substantial compliance with the documents and testimony on record. 482 of 549 Dear Zoning Board, Several neighbors of the Chabad House and Rabbi Klein have engaged in ongoing discussions about the proposed renovations to the Chabad House. As a part of those discussions, the neighbors signed below support the Chabad House’s application to renew its special use permit provided that the following conditions are included in the permit. These conditions are based on the conditions that are in the Chabad House’s current Special Use Permit 94-0-78 dated 1978. 1. Use of the premises shall be limited to a maximum of thirty (30) persons or a lesser number if required by fire, safety or building restrictions. 2. Use of the premises shall be limited to religious services and related study and discussion groups and similar type activities. 3. Use of the premises will exclude other uses described in Evanston Zoning Ordinance Section 6-8-2-4 including, use as a bed and breakfast establishment, cemetery, child residential care home, daycare center, planned development, public utility, residential care home or a transitional treatment facility. 4. The building shall be soundproofed, or activities within it limited so that sound generated within the building cannot be heard at the property line of adjoining lots. 5. All of the off-street parking spaces required to serve the actual uses of the building shall be supplied. 6. No persons shall eat or sleep on the premises, except for one person, his or her spouse, their offspring and legally adopted children; provided however, that the foregoing restrictions shall not apply to food served in connection with religious services and provided, further, that up to four (4) religious observants may sleep on the premises on the night of the Jewish Sabbath and the Jewish holidays. 7. Lubavitch Chabad of Evanston, Inc., agrees that during its occupancy of the premises it will not operate or avail itself of a van or truck in connection with its occupancy or ownership of the premises. 8. The special use shall apply only to the Lubavitch Chabad of Evanston, Inc. and will terminate if the Lubavitch Chabad of Evanston, Inc. sells or vacates the premises. 9. That a covenant in recordable form be executed and delivered to the City of Evanston by the applicant reciting agreement to such conditions. Thank you for your consideration. Sincerely, Bill and Emilie Hogan 483 of 549 Karen Nelson and Rob Biesenbach Jackie and Dave Mack Andrew and Rachel Sollinger Dave Schoenfeld Pat Atkins 484 of 549 APPROVED Preservation Commission Page 1 of 3 MEETING MINUTES (EXCERPT) EVANSTON PRESERVATION COMMISSION Tuesday, August 29, 2017 Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Room 2404 7:00 P.M. Members Present: Robert Bady, Elliott Dudnik, Ken Itle, Julie Hacker, Mark Simon, Tim Schmitt, and Diane Williams Members Absent: Sally Riessen Hunt and Karl Vogel Staff Present: Scott Mangum, Planning and Zoning Administrator, Division Manager Carlos Ruiz, Senior Planner/Preservation Coordinator Presiding Member: Diane Williams, Chair CALL TO ORDER / DECLARATION OF QUORUM Chair Williams called the meeting to order at 7:02 pm with a quorum present. OLD BUSINESS B. 2014 Orrington Av. (NEHD) – Dov Hillel Klein, applicant. Exterior remodeling for ADA accessibility; partial 3rd floor/attic addition to accommodate needed spaces; updated front and rear facades; new elevator for ADA accessibility. Requires Zoning Variations: 6-8-2-4 special use permit for a religious institution required due to increase in building/impact. 6-8-2-9-A Maximum height permitted is 35' to peak or 2.5 stories, whichever is less. Proposed height 35' to peak of roof (excluding rear parapet and elevator overrun). However, knee-wall exceeds 3' and therefore constitutes a full 3rd story. 6-18-3 Exterior knee-walls shall not exceed three (3) feet in height. 6-8-2-8-B-3 15' interior side yard setbacks required for non-residential structure. Propose 5.4' north interior side yard setback and 9.5' south interior side yard setback for additions, front porch, rear balcony. 6-4-1-9-A-3 Block average's front yard setback (to house facades, not porches) is 34' and existing setback is 27.3'. Proposed front yard setback 27.3' (extending higher than existing). 6-4-1-9-B Eaves may extend 10% into a setback or a minimum of 6". Front porch eave setback = 27.6'. Proposed front porch eave setback is 24.8'. Applicable standards: [Alteration] 1-10; [Construction] 1-16; [Demolition] 1-5; [Zoning Variation] A and C. Rabbi Klein and Kiril Mirintchev, architect, presented the project for remodeling and adding an attic floor to the building at 2014 Orrington. The 2-flat building was purchased 40 years ago as a Synagogue and student center. In 1985, after a decision by the United States Supreme Court, the Synagogue and student center opened its doors. The Chabad Center serves four distinct populations: 1) Synagogue community 2) students, faculty and staff of Northwestern University, 3) the secular Jewish community of Evanston, ad 4) the overall Evanston community. 485 of 549 APPROVED Preservation Commission Page 2 of 3 Rabbi Klein said they need to add space for making the building accessible with a ramp and elevator, dedicated rooms for the different activities, classrooms, ADA bathrooms, office space for their staff, an appropriate kitchen(s) and a Sanctuary and meditation space. To this end, instead to making the building longer, a partial third floor is being added. The original plan was developed with the input of City administrators, community members and neighbors. The design has a strong Synagogue feel and it blends with the existing landscape. Based on the input from neighbors, architect Kiril Mirintchev redesigned the front of the building for a more residential feel than a Synagogue feel. At the time the revised design was presented at the neighborhood meeting, no one objected. K. Mirintchev said because the Zoning limitation of height in a residential zone, the proposed attic is not a full floor. However, Zoning considers it a third floor. The existing setbacks are smaller than required, 7’ and 5’, where 15’ is required. The height is 35’. He described the Zoning Variations as listed above. The floor plans add an attic floor with classrooms and offices. The floors below become accessible; there is an elevator and a ramp outside. With the remodel there will be a better entrance, Sanctuary, library, and kitchen. The proposed attic will not be visible from the street because the existing parapet walls will block its view. The front elevation has a residential feel with a new dormer and a combination of gable and hip roofs with the same line of eave as all the buildings on the block have. The existing brick side walls remain. The front pilasters and structural columns will remain. The two columns on the side will be shorten and the middle one stops even shorter at the new roof for the new front dormer above. K. Mirintchev said they removed from the front elevation the elements that are not characteristics of the neighborhood (the front element with its large windows, stucco window sills, and the partial roof). Instead, the gable roof with the dormer on the front is proposed. The side walls remain almost the same and the rear addition elevation corresponds with the brick buildings across the alley. On the front elevation the new large gable roof with a projecting eave reduce the bulkiness of the building. The materials are: brick on the front, stucco at the rear addition, and standard shingles for the roofs. All the front elements are wood; the windows are dark bronze aluminum with tinted glass. Public Comments: Jack Weiss of 813, #2 Forest Av. said the proposed design fails to meet standards of alteration 1, 9 and 10; and standards of construction 1, 2, 4, 8 and 10. Rob Biesenbach of 2011 Orrington said his concern is about the aesthetic of the design. There is too much glass and the design is not quite fitting with the residential character of the neighborhood. He suggested continuing working on the design Dave Mack of 2015 Orrington concurred with Rob Biesenbach’s remarks. He said the building is an eyesore and needs work. Patricia Atkins of 2005 Orrington said that after the two neighborhood meetings, she found the designs of the enlarged space and raised roof, advancing front, and altered 486 of 549 APPROVED Preservation Commission Page 3 of 3 windows, to be out of character and incompatible with the neighborhood and its single family residential character. The design does not meet standards of alteration 1, 2, 3, 6, 9 and 10. Ms. Atkins objected to the Institutional uses, specifically the classroom and offices associated with the proposed design. Kiril Mirintchev said the proposed front elevation blends in the residential neighborhood, but the function of the building is different with a little bit of expression of its functionality. The proportion width and height are the same as some the buildings on the block. The look is different because its function. Commissioner Simon asked about the buildings across the alley. K Mirintchev said the buildings are four-story brick buildings. Commissioner Simon wondered how to apply preservation standards on a building that is a non-contributing structure to the district. Chair Williams said that, to some degree, it is about the context. Commissioner Dudnik questioned whether the Commission should review this as a residential building, when it is not. Commissioner Hacker said it is about looking at the buildings on the block, looking at the proportion of the windows and such. Commissioner Dudnik said the proposed front elevation is busy with a dormer of one type, another dormer of a different type. The other issue is the scale of the second floor; the dormer is over scaled. The windows on the second floor, compared to the windows on the first floor, are out of scale. If the Commission were to review the front elevation in a residential context, then it is a problem. On the front elevation the roofs seemed to be of the different height. On the side elevation all of roofs are lined up. K. Mirintchev clarified that the front elevation shows the roofline that is at the rear of the building as well. Commissioners discussed particularly the proposed large dormer on the front elevation as being out of scale, the excessive amount of glass on the second floor and attic, the mismatch style of the existing first floor and the proposed second floor with different roof lines. Commissioners suggested simplifying the design for it to be more compatible with residential context of the block, and yet still express the function and the Chabad House use. Commissioner Bady made a motion to continue the item to September 19, 2017, seconded by Commissioner Simon. The motion passed. Vote: 7 – 0. Respectfully submitted, Carlos D. Ruiz Senior Planner/Preservation Coordinator 487 of 549 APPROVED Preservation Commission Page 1 of 4 MEETING MINUTES (EXCERPT) EVANSTON PRESERVATION COMMISSION Tuesday, October 17, 2017 Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Room 2404 7:00 P.M. Members Present: Elliott Dudnik, Ken Itle, Julie Hacker Jamie Morris, Suzi Reinhold, Mark Simon, Karl Vogel, and Diane Williams Members Absent: Robert Bady, Sally Riessen Hunt, and Tim Schmitt, Staff Present: Scott Mangum, Planning and Zoning Administrator, Division Manager; Carlos Ruiz, Senior Planner/Preservation Coordinator, and Mario Treto, Assistant City Attorney II. Presiding Member: Diane Williams, Chair CALL TO ORDER / DECLARATION OF QUORUM Chair Williams called the meeting to order at 7:02 pm with a quorum present. OLD BUSINESS A. 2014 Orrington Av. (NEHD) – Dov Hillel Klein, applicant. Exterior remodeling for ADA accessibility; partial 3rd floor/attic addition to accommodate needed spaces; updated front and rear facades; new elevator for ADA accessibility. Requires Zoning Variations: 6-8-2-4 special use permit for a religious institution required due to increase in building/impact. 6-8-2-9-A Maximum height permitted is 35' to peak or 2.5 stories, whichever is less. Proposed height 35' to peak of roof (excluding rear parapet and elevator overrun). However, knee-wall exceeds 3' and therefore constitutes a full 3rd story. 6-18-3 Exterior knee-walls shall not exceed three (3) feet in height. 6-8-2-8-B-3 15' interior side yard setbacks required for non-residential structure. Propose 5.4' north interior side yard setback and 9.5' south interior side yard setback for additions, front porch, rear balcony. 6-4-1-9-A-3 Block average's front yard setback (to house facades, not porches) is 34' and existing setback is 27.3'. Proposed front yard setback 27.3' (extending higher than existing). 6-4-1-9-B Eaves may extend 10% into a setback or a minimum of 6". Front porch eave setback = 27.6'. Proposed front porch eave setback is 24.8'. Applicable standards: [Alteration] 1-10; [Construction] 1-16; [Demolition] 1-5; [Zoning Variation] A and C. Rabbi Dov Hillel Klein and Kiril Mirintchev, architect, presented the application. Rabbi Klein said that 2014 Orrington is a building of wordship, and as such it can only be in a residential area. It operates under a zoning variance, with approval of City Council, and a Court order that was challenged, but it was upheld by the Supreme Court of the United States in 1983. The synagogue is one of several non-conforming structures in one block radius. The goal is to upgrade the facility and how the building looks in order 488 of 549 APPROVED Preservation Commission Page 2 of 4 to increase the value of the neighborhood, enhance to its life, and make the facility accessible and safe. Rabbi Klein said they want to be sensitive and extremely caring to their neighbors. They are willing to create a balance and made their facility look and appear more residential. Rabbi Klein said the Lakeshore Historic District (2012 Survey) shows there is a distinction between residential, non-residential architecture, and religious facilities. There are seven religious facilities in the district, and five of them are historic. Clearly in 2012 there was an understanding that religious facilities should not be treated like residential facilities. The proposed design takes elements from the neighborhood and fits right in. Jewish law requires a synagogue to have windows. Other religious centers including other synagogues in Evanston are filled with windows. Rabbi Klein showed examples of other religious and residential buildings in the Northeast Evanston Historic District with fairly amount of windows. Rabbi Klein said based on the Commission’s and the neighbors’ comments the revised design is unique, it blends with the nature of the block and they will be changing the synagogue from one that does not conform into one that will live up to the Northeast Evanston Historic District. Kiril Mirintchev listed the comments from the Commission as follows:  The bulkiness of the top floor as compared to the bottom floor.  The use of brick material on the sides of the dormer.  The large openings of the windows, not being proportionally scaled towards the rhythm of openings and solids parts of walls in the neighboring buildings.  The whole façade is too complicated. Kiril Mirintchev described the revisions to the front facade as follows:  The roof is the same; the width of the dormer is reduced by a foot by removing the brick pilasters, and replacing them with simple framed walls with stucco finish.  The sloped roof behind the dormer has been removed, so now one can see a straight horizontal line, bringing more unity to the front elevation.  With a slimmer dormer, the roof is steeper. It looks more elegant rather than bulky.  More solid parts were added to the dormer windows with a different rhythm. Now it resembles the proportions of the windows on two houses on the block.  The revisions allow the front façade to merge or blend better with the residential environment around it.  The front façade represents the character of the building as a synagogue.  The ridge height of the building is lower than the adjacent buildings, and the gable roof on the dormer corresponds to the size of gables around it. 489 of 549 APPROVED Preservation Commission Page 3 of 4  The revisions bring the design closer to the adjacent buildings and the character of the neighborhood. Thus, presenting the building as a non-residential building which is its character. Public comments: Gerry Melkov of 901 Colfax said what it should be preserved is the diversity of Evanston. The proposed partition of the window into three panels addresses his concern about the aesthetics of it. Ellen Wodika of 1508 Oak, 2S said she was pleased with the proposed design and for the Chabad House being part of the community. Bob Bisenback of 2011 Orrington said the windows and drawings continue to make progress. He wants the Chabad House continue to be a great neighbor and the building blend in as much as possible into the residential character. Dave Mack of 2015 Orrington said he supports having the Chabad House in the neighborhood and will follow what the Commission wants to do. Jesse Viner of 1130 Judson said the project meets long overdue needs of the Jewish community in Evanston. He believes the process underway represents the diversity and integration of the community. Laura Viner of 1130 Judson said a very important aspect of her life is her strong affiliation with the Chabad House. The process reflects Rabbi Klein’s intention to be completely cooperative and transparent in the way he approached the process with the Commission and the neighborhood. She supports the project and believes the design meets the criteria to be both collaborative and blending with the community and the residential aspect. Sholom Hecht of 1107 Garrett Pl. said that the proposed design meets the standards and goes above and beyond than others structures in the neighborhood and historic district. Chair Williams said the Commission received a letter from Jack Weiss that says essentially the proposed changes fail to respond to the concerns of mass and scale of the neighborhood. Commission’s questions and comments: Elliott Dudnik:  Religious buildings in most communities do not necessarily reflect the residential character of the rest of the block.  Do our standards encompass the issue of a building of different type and use and so on, relative to the other buildings? 490 of 549 APPROVED Preservation Commission Page 4 of 4  The issue is not the scale of the windows, but the way they are imposed on the front elevation, given the scale of all other windows. The mullions or the divisions between the windows could be more broken down. Commissioner Hacker:  The dormer windows could be double hung and keeping with the scale of the existing windows. Also, the rear façade is within the purview of the Commission. Chair Williams asked about the windows on the side of the dormer. K. Mirintchev the side windows are divided and with an arch. The addition on top is also stucco. Chair Williams asked Mario Treto for direction to allow no more than two Commissioners provide feedback and guidance to the applicant to continue working on revisions to the design. M. Treto said it needs to be clear that it would be any indication as to approval by the whole Preservation Commission and just provide input as to the design. Commissioner Itle:  The conflict is what is happening in the first floor; its scale, material and character do not relate to the second floor. The windows on the first floor seemed too small and out of scale. Chair Williams said that, based on the discussion, the applicant will lighten up the second floor windows and look at the first floor. The revised drawings would be circulated by City staff to no more than two (2) Commissioners. Commissioner Itle made a motion to table the application at 2014 Orrington Av. until November 14, 2017, seconded by Commissioner Dudnik. The motion passed. Vote: 7 ayes, 0 nays. Respectfully submitted, Carlos D. Ruiz Senior Planner/Preservation Coordinator Next Meeting: TUESDAY, November 14, 2017 at 7:00 P.M. (Subject to change) 491 of 549 APPROVED Preservation Commission Page 1 of 2 MEETING MINUTES (EXCERPT) EVANSTON PRESERVATION COMMISSION Tuesday, November 14, 2017 Lorraine H. Morton Civic Center, 2100 Ridge Avenue, Room 2404 7:00 P.M. Members Present: Robert Bady, Elliott Dudnik, Ken Itle, Julie Hacker, Jamie Morris, Suzi Reinhold, Tim Schmitt, and Mark Simon Members Absent: Sally Riessen Hunt, Karl Vogel, and Diane Williams Staff Present: Scott Mangum, Planning and Zoning Administrator, Division Manager; Carlos Ruiz, Senior Planner/Preservation Coordinator, Presiding Member: Ken Itle, Vice Chair CALL TO ORDER / DECLARATION OF QUORUM Vice Chair Itle called the meeting to order at 7:04 pm with a quorum present. OLD BUSINESS A. 2014 Orrington Av. (NEHD) – Dov Hillel Klein, applicant. Exterior remodeling for ADA accessibility; partial 3rd floor/attic addition to accommodate needed spaces; updated front and rear facades; new elevator for ADA accessibility. Requires Zoning Variations: 6-8-2-4 special use permit for a religious institution required due to increase in building/impact. 6-8-2-9-A Maximum height permitted is 35' to peak or 2.5 stories, whichever is less. Proposed height 35' to peak of roof (excluding rear parapet and elevator overrun). However, knee-wall exceeds 3' and therefore constitutes a full 3rd story. 6-18-3 Exterior knee-walls shall not exceed three (3) feet in height. 6-8-2-8-B-3 15' interior side yard setbacks required for non-residential structure. Propose 5.4' north interior side yard setback and 9.5' south interior side yard setback for additions, front porch, rear balcony. 6-4-1-9-A-3 Block average's front yard setback (to house facades, not porches) is 34' and existing setback is 27.3'. Proposed front yard setback 27.3' (extending higher than existing). 6-4-1-9-B Eaves may extend 10% into a setback or a minimum of 6". Front porch eave setback = 27.6'. Proposed front porch eave setback is 24.8'. Applicable standards: [Alteration] 1-10; [Construction] 1-16; [Demolition] 1-5; [Zoning Variation] A and C. Kiril Mirintchev, architect, presented the application. K. Mirintchev said the revised front elevation second story windows are more proportionally sized, where the arched window was lowered and the side windows are more residential scale. The stucco was removed; instead wood is being used, adding more detail. The exterior materials include wood siding at the top of the gable and on the sides of the added third level. The main dormer has a much slimmer look and is in sync with its surroundings. The elements that 492 of 549 APPROVED Preservation Commission Page 2 of 2 surround the windows have more detailing with a horizontal mullion, making them look slimmer. On the sides, the large triangular windows are simplified with a horizontal mullion. The trim around the windows has typical elements for residential construction. The front elevation is similar with all the gables of the surrounding houses and maintains the setback line of the porches of the neighboring structures. Commissioner Dudnik said the proposed design is a better solution than before. Commissioners Schmitt and Morris concurred. Commissioner Schmitt made a motion to issue a COA for 2014 Orrington Av. as submitted, in that standards for alteration 1-10 apply, seconded by Commissioner Simon. The motion passed. Vote: 7 ayes, 1 nay (Commissioner Itle). Commissioner Schmitt made a motion to issue a COA for 2014 Orrington Av., in that standards for construction 1-16 apply, seconded by Commissioner Simon. The motion passed. Vote: 7 ayes, 1 nay (Commissioner Itle). Commissioner Schmitt made a motion to issue a COA for 2014 Orrington Av. in that standards for demolition 1-5 apply, seconded by Commissioner Simon. The motion passed. Vote: 7 ayes, 1 nay (Commissioner Itle). Commissioner Schmitt made a motion to issue a recommendation to the Zoning Board of Appeals for the project at 2014 Orrington Av. for Zoning variances, in that standards A and C have been met, seconded by Commissioner Simon. The motion passed. Vote: 7 ayes, 1 nay (Commissioner Itle). Respectfully submitted, Carlos D. Ruiz Senior Planner/Preservation Coordinator 493 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 FF II NN DD II NN GG SS FOR STANDARDS OF SS PP EE CC II AA LL UU SS EE PP EE RR MM II TT SS In the case of After conducting a public hearing on January 9, 2018, the Zoning Board of Appeals makes the following findings of fact, reflected in the audio-visual recording of the hearings, based upon the standards for special uses specified in Section 6-3-5-10 of the Zoning Ordinance: Standard Finding (A) It is one of the special uses specifically listed in the zoning ordinance; ___X__Met _____Not Met Vote 4-0 (B) It is in keeping with purposes and policies of the adopted comprehensive general plan and the zoning ordinance as amended from time to time; ___X___Met _____Not Met Vote 4-0 (C) It will not cause a negative cumulative effect, when its effect is considered in conjunction with the cumulative effect of various special uses of all types on the immediate neighborhood and the effect of the proposed type of special use upon the city as a whole; ___X___Met _____Not Met Vote 4-0 (D) It does not interfere with or diminish the value of property in the neighborhood; ___X___Met _____Not Met Vote 4-0 Case Number: 17ZMJV-0018 Address or Location: 2014 Orrington Ave. Applicant: Rabbi Dov Hillel Klein, property owner Proposed Special Use: Expansion of a Religious Institution, Lubavich Chabad of Evanston, LLC 494 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 (E) It can be adequately served by public facilities and services ___X___Met _____Not Met Vote 4-0 (F) It does not cause undue traffic congestion; ___X___Met _____Not Met Vote 4-0 (G) It preserves significant historical and architectural resources; ___X___Met _____Not Met Vote 4-0 (H) It preserves significant natural and environmental features; and ___X___Met _____Not Met Vote 4-0 (I) It complies with all other applicable regulations of the district in which it is located and other applicable ordinances, except to the extent such regulations have been modified through the planned development process or the grant of a variation. ___X___Met _____Not Met Vote 4-0 and, based upon these findings, and upon a vote __4__ in favor & __0__ against Recommends to the City Council _____ approval without conditions _____ denial of the proposed special use __x__ approval with conditions specifically: 1. Use of the premises shall be limited to a maximum of 30 persons or a lesser number if required by fire, safety or building restrictions. 2. Use of the premises shall be limited to religious services and related study and discussion groups and similar type activities. 3. Use of the premises outside of the uses permitted for a Religious Institution, will exclude other special uses described in Evanston Zoning Ordinance Section 6-8- 2-4 including use as a bed and breakfast establishment, cemetery, child residential care home, daycare center, planned development, public utility, residential care home or a transitional treatment facility. 4. The building shall be soundproofed, or activities within it limited so that sound generated within the building cannot be heard at the property line of the adjoining lots. 5. All of the off-street parking spaces required to serve the actual uses of the building shall be supplied. 6. No persons shall eat or sleep on the premises, except for one person, his or her spouse, their offspring and legally adopted children; provided however, that the 495 of 549 P LANNING AND Z ONING D IVISION 847-448-8230  zoning@cityofevanston.org Community Development Department  www.cityofevanston.org/zoning 2100 Ridge Ave., Rm. 3202 Evanston, IL 60201 foregoing restrictions shall not apply to food served in connection with religious services and provided, further, that up to 4 religious observants may sleep on the premises on the night of the Jewish Sabbath and the Jewish holidays. 7. Lubavitch Chabad of Evanston, Inc. agrees that during its occupancy of the premises it will not operate or avail itself of a van or truck in connection with its occupancy or ownership of the premises. 8. That a covenant in recordable form be executed and delivered to the City of Evanston by the applicant reciting agreement to such conditions. 9. Substantial compliance with the documents and testimony on record. Attending: Vote: Aye No ___X__ Mary Beth Berns __X__ ____ _______ Myrna Arevalo _____ ____ ___X___ Scott Gingold __X__ ____ ___X___ Violetta Cullen __X__ ____ ___X___ Lisa Dziekan __X__ ____ _______ Mary McAuley _____ ____ _______ Kiril Mirintchev _____ ____ 496 of 549 FF II NN DD II NN GG SS FOR STANDARDS OF VV AA RR II AA TT II OO NN SS In the case of After conducting a public hearing on January 9, 2018, the Zoning Board of Appeals makes the following findings of fact, based upon the standards for major variances specified in Section 6-3-8-12 of the City Code: Standard Finding (A) The requested variation will not have a substantial adverse impact on the use, enjoyment or property values of adjoining properties; ___X___Met _____Not Met 4-0 (B) The requested variation is in keeping with the intent of the zoning ordinance; ___X___Met _____Not Met 4-0 (C) The alleged hardship or practical difficulty is peculiar to the property; ___X___Met _____Not Met 4-0 (D) The property owner would suffer a particular hardship or practical difficulty as distinguished from a mere inconvenience if the strict letter of the regulations were to be carried out; ___X___Met _____Not Met 4-0 (E) The purpose of the variation is not based exclusively upon a desire to extract additional income from the property; or there is a public benefit; ___X___Met _____Not Met 4-0 Case Number: 17ZMJV-0018 Address or Location: 2014 Orrington Ave. Applicant: Rabbi Dov Hillel Klein, property owner Proposed Zoning Relief: Front yard and interior side yard setbacks, and third story height for an addition to a Religious Institution 497 of 549 (F) The alleged difficulty or hardship has not been created by any person having an interest in the property; __X___Met _____Not Met 4-0 (G) The requested variation is limited to the minimum change necessary to alleviate the particular hardship or practical difficulty which affects the property; __X___Met _____Not Met 4-0 and, based upon these findings, and upon a vote of __4__ in favor & __0__ against recommends to the City Council __X___ approval with conditions: _____ denial 1. The project must be developed in substantial compliance with the documents and testimony on record. Attending: Vote: Aye No __X__ Violetta Cullen _X__ ____ __X__ Mary Beth Berns _X__ ____ __X__ Lisa Dziekan _X__ ____ _____ Kiril Mirintchev ____ ____ __X__ Scott Gingold _X__ ____ _____ Myrna Arevalo ____ ____ _____ Mary McAuley ____ ____ 498 of 549 For Planning & Development Committee of February 12, 2018 Item PD1 Lakefront Policy for Private Land For Discussion To: Members of the Planning & Development Committee From: Johanna Leonard, Director of Community Development Gary Gerdes, Building & Inspection Services Division Manager Ingrid Eckersberg, Civil Engineer Subject: Lakefront Policy for Private Land Date: February 5, 2018 Recommended Action: Staff recommends that the City Council review, discuss and provide guidance in creating potential code amendments to the City’s Floodplain Ordinance (Title 4, Chapter 13) on private shoreline protection work and the potential expansion of private lakeshore property via fill of the public waters of Lake Michigan. Funding Source: Not applicable at this time. Livability Benefits: Natural Systems: Protect and Preserve Natural Characteristics of Lake Michigan Lakefront Summary: There are approximately 42 private residential lakefront properties in the City with varying shore characteristics, see listing in Exhibit A. These properties are on the official FEMA designated floodplain. Recent high lake levels and heavy wave action have degraded the shores of many of these properties resulting in an increased amount of restoration projects. Property descriptions for shoreline lots generally differ from inland lots in their definition of the east property line. A common description delineating the location of the coastal (east) property line is, “the waters’ edge as it exists over time at rest”. As a result of the fluctuation of lake levels from year-to-year, these properties’ areas are somewhat dynamic as the eastern lot line may be closer to the structures on the property one year Memorandum 499 of 549 when lake levels are high and farther away in other years when lake levels are low. These properties are also subject to shifting by constructed stone revetments, seawalls and breakwaters. Some restoration projects have resulted in earthwork filling and construction beyond the historic eastern lot boundary. Beach areas and adjacent waters of the lake are public according to the Illinois Department of Natural Resources (IDNR) and Illinois Environmental Protection Agency (IEPA). The IDNR’s code regulating public water (Title 17 Part 3704, Section 3704.70 a) states: The conversion of public waters to private land by filling is prohibited. Currently, permit application for shoreline construction projects are filed through a joint application to the U.S. Army Corp of Engineers (USACE), IDNR and IEPA. Review and permitting is also required at the local level pursuant to the City’s floodplain ordinance but typically the City is receiving project information after USACE, IDNR/OWR and IEPA review and provide approval. To address these concerns, staff recommends the following updates for the City Code (Title 4, Chapter 13 – Floodplain Regulations): • Concurrent review of projects with other State and Federal approval agencies issuing permits for shoreline work that include but are not limited to IDNR, USACE, and IEPA; • Notice requirement to adjacent property owners within a specified distance of the north and south property lines at the time of permit application submittal; • Prohibit conversion of public water of Lake Michigan to private lakeshore property via fill; and • Require plat of survey be submitted after completion of shoreline project to detail as-built conditions and verify property lines are consistent with pre-construction approved plans. The proposed requirements would be to prevent conversion of public waters into private land through lakeside fill; ensure City staff review at the appropriate time and to ensure adjacent property owners receive proper notification of pending shoreline protection projects, it does not prevent private measures to preserve, restore and protect littoral properties. Attachments: Exhibit A - Lakefront Residences 500 of 549 Lakefront Residences Address Characterization of east property line, PL, and Lake Michigan shore City shore permits Type 1 707 Sheridan some type of retaining wall at PL then sandy beach with curved rock groin 12MSWK-0047 sandy beach fill, stone breakwater groins 2 713 Sheridan no wall at PL, then sandy beach withy curved rock groin 12MSWK-0046 sandy beach fill, stone breakwater groins 3 715 Sheridan no wall at PL, then sandy beach withy curved rock groin 12MSWK-0047 sandy beach fill, stone breakwater groins 4 721 Sheridan no wall at PL, then sandy beach withy curved rock groin 12MSWK-0048 sandy beach fill, stone breakwater groins 5 729 Sheridan piling at PL with stone revetment 6 735 Sheridan natural shore flanked by short rock piles 7 90 Kedzie piling at PL with stone revetment 8 901 Edgemere mostly natural shore 9 907 Edgemere mostly natural shore 10 911 Edgemere mostly natural shore 11 917 Edgemere sheet piling at PL 12 919 Edgemere sheet piling at PL 13 925 Edgemere piling at PL with stone revetment USACE permit 14 929 Edgemere sheet piling at PL 15 935 Edgemere piling at PL with stone revetment 16 943 Edgemere piling with stone revetment at PL then natural beach next to City long sheet pile groin 17 8 Milburn Pk some type of retaining wall at PL, then wide natural beach 18 7 Milburn Pk some type of retaining wall at PL, then wide natural beach 19 6 Milburn Pk some type of retaining wall at PL, then wide natural beach 20 5 Milburn Pk some type of retaining wall at PL, then wide natural beach 21 568 Ingleside Pk some type of retaining wall then stone piles to sandy beach at PL 22 568 Ingleside Pk some type of retaining wall then stone piles to sandy beach at PL 23 581 Ingleside Pk some type of retaining wall then stone piles to sandy beach at PL 24 581 Ingleside Pk some type of retaining wall then stone piles to sandy beach at PL 25 585 Ingleside Pl some type of retaining wall at PL then sandy beach 26 2715 Sheridan some type of retaining wall at PL then stone revetment then sandy beach with short stone groin 16MSWK-0123 most rebuild, extension of breakwater groins 27 2719 Sheridan some type of retaining wall at PL then stone revetment then sandy beach 16MSWK-0123 most rebuild, extension of breakwater groins 28 2729 Sheridan some type of retaining wall at PL then sandy beach with concrete block groin 16MSWK-0123 most rebuild, extension of breakwater groins 29 2737 Sheridan some type of retaining wall at PL then stone revetment 30 2735 Sheridan sheet piling at PL then stone revetment 31 2805 Lakeside Ct sheet piling at PL with another row of sheet piling with block groin 32 2809 Lakeside Ct sheet piling at PL with another row of sheet piling 17MSWK-0112 fill extends property 33 2815 Lakeside Ct sheet piling at PL with other structures built beyond 17MSWK-0111 fill extends property 34 2827 Sheridan Pl sheet piling at PL with another row of sheet piling 35 2831.5 Sheridan Pl sheet piling at PL with another row of sheet piling, sheet pile groin at N 36 2835 Sheridan Pl sheet piling at PL, sheet pile groin at S 37 2837 Sheridan Pl sheet piling at PL 38 2839 Sheridan Pl sheet piling at PL with stone revetment and short pier, sheet piling groin 39 706 Roslyn Pl sheet piling at PL with stone revetment 40 707 Roslyn Pl sheet piling at PL 41 711 Roslyn Pl sheet piling at PL 42 725 Roslyn Pl sheet piling at PL, groin with stone revetment N of 501 of 549 For City Council Meeting of February 12, 2018 Item O1 Business of the City by Motion, Storefront Modernization Program For Action To: Honorable Mayor and Members of the City Council From: Martin Lyon, Assistant City Manager Paul Zalmezak, Economic Development Division Manager Cindy Plante, Economic Development Coordinator Subject: 2018 Changes to the Storefront Modernization Program Date: November 22, 2017 Recommendation: Staff recommends restructuring the Storefront Modernization Program guidelines for Fiscal Year 2018 to provide a targeted and equitable eligibility tier that would provide 100% funding up front for façade renovations within the city’s Neighborhood Stabilization Program geography. Funding Source: Up to $100,000 in funding is to be provided by the Business District Improvement Fund (Account 100.15.5300.65522) for the Storefront Modernization Program for 2018. Livability Benefits: Economy & Jobs: Retain and expand local businesses Built Environment: Enhance public spaces Equity & Empowerment: ensure equitable access to community assets Background: Originally known as the Façade Improvement Program, the Storefront Modernization program provides funding assistance for small businesses or commercial property owners to update and maintain street-level retail spaces in Evanston’s business districts. For much of its history, the program provided a matching reimbursement of up to 50% of the cost of eligible projects including exterior windows, doors, lighting, signage, painting, and masonry repair. Memorandum 502 of 549 2 The eligibility guidelines were expanded in 2015 to add funding eligibility for interior renovation projects in certain circumstances. Applicants were eligible to request up to $50,000 as a 50% matching reimbursement for interior renovation or build out projects based on use (retail goods establishments) or property location (Howard Street, Dodge Avenue, or any business districts West of Ridge Avenue except Central Street). Since 2015, this provision has been used for three major projects: 1806 Church St, 709-711 Howard Street (Good to Go restaurant), and 1324 Dodge Ave. (Sharp Edge Crossfit), in addition to plumbing upgrades at 807 Howard St. A review of the program presented to the Economic Development Committee in June of 2017 showed that the Storefront Modernization Program has funded an average of seven projects each fiscal year between 2012 and 2017, and total annual program spending has only exceeded $100,000 twice: $200,000 in FY15 and just under $150,000 in FY17. In addition, the review also showed that despite the expansion of eligibility guidelines in 2015, the program has not been utilized in areas most in need of facade improvements including Church and Dodge, Church and Emerson, and Simpson and Dodge. Summary: In an effort to bring the program budget in line with program spending as part of preparation of the 2018 City Budget, the total funding allocation for the Storefront Modernization Program for 2018 was limited to $100,000. For FY 2018, staff proposes eliminating eligibility for interior renovations and capping reimbursements for eligible façade improvement projects at $25,000 per applicant. The program will function much as it had prior to 2015. Staff also recommends adding a targeted incentive to provide up to 100% of funding (up to $25,000) for eligible façade improvement projects located in the geography identified in the Neighborhood Stabilization Plan II (NSP2), which provided HUD funding for foreclosure prevention and housing stabilization projects in Census tracts identified as having a higher percentage of low- to moderate- income residents. A map of the NSPII areas is attached. Attachments: Proposed 2018 Storefront Program Guidelines 503 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 1 2018 City of Evanston Storefront Modernization Program Program Guidelines C I T Y M A N A G E R ’S O F F I C E E C O N O M I C D E V E L O P M E N T D I V I S I O N 2100 R IDGE A VENUE , E VANSTON , I LLINOIS 60201 847-448-4311 | INFO@EVANSTONEDGE.COM | WWW.EVANSTONEDGE.COM | WWW.CITYOFEVANSTON.ORG 504 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 2 Program Purpose and Overview The purpose of the Storefront Modernization Program (“the Program”) is to improve the appearance and functionality of street-level commercial buildings located throughout the City of Evanston and to support the development of retail and experience-based uses within the City. The Program is intended to address deteriorating and obsolete property conditions and encourage facade, accessibility and/or sustainability improvements to commercial property as a means to generate additional business for Evanston’s business districts. After being approved for funding, program participants are eligible to receive a rebate upon the completion of their project (“the Project”). The rebate is in the form of a loan, forgivable over a five (5) year period. The Program is managed and administered by the Economic Development Division of the City Manager’s Office. Eligibility Criteria Users of street-level commercial spaces are eligible to seek up to $25,000 in funding for exterior (façade) improvements such as signage, lighting, tuck pointing, awnings, doors, and windows. Eligible participants of the Program include property owners and tenants of street-level commercial spaces within Evanston. A business owner who is leasing space must:  Be current on all fees and taxes owed to the City of Evanston;  Have a current executed lease with a minimum of five (5) years remaining from the date of Application or provide evidence that the business has operated in Evanston for over five (5) years; and  Provide written approval from the property owner to participate in the Program and consent to recordation against the subject property of a Declaration of Covenants Affecting the Property (for projects receiving a forgivable loan of $10,000 or more). Preference will be given to projects in which property owners also contribute investment in tenant improvements. Ineligible applicants include:  National franchises/for profit corporations with more than ten locations outside of Evanston, unless the organization is headquartered in Evanston;  Occupants or owners of buildings that are not current with property taxes, water bills, or properties possessing any sort of non-mortgage liens (i.e. mechanics lien, etc.);  Persons who have one or more outstanding City of Evanston parking tickets;  Buildings in excess of an 80,000 square foot footprint;  Churches or other religious organizations;  Government offices and agencies (non-governmental tenants are eligible);  New construction, less than five (5) years old; and  Property that has received storefront improvement funds (formerly known as the City of Evanston’s Façade Improvement Program) within the past five (5) years  Vacant spaces or those for which there isn’t a lease of at least five (5) years in place 505 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 3 There are two levels of eligibility depending on the location of the property: Maximum funding Eligible Expenses Location/use requirements Basic 50% rebate up to $25,000 max based on frontage Façade improvements only (signs, windows, doors, tuck pointing, lighting, painting, etc.) None Targeted 100% funding Up to $25,000 max Façade improvements only (signs, windows, doors, tuck pointing, lighting, painting, etc.) Must be located within NSP2 target areas (highlighted on map below) Façade Improvements: the façade is defined as the portion of a building that faces the public right-of-way and is fronted by a sidewalk or similar pedestrian-oriented pathway. Eligible improvements include ramps, door openers, signage, painting, lighting, windows, doors, fascia, tile, canopies, awnings, trim, metal work and other decorative elements, restoration of historic properties and other improvements contributing to the visual enhancement or accessibility of a property as it relates to the public right-of-way. Any projects requesting reimbursement for more than $3,000 must have a storefront that complies with the Illinois Accessibility Code. For the purposes of considering projects, a storefront is considered the entire length of the building that faces the street, regardless of how many individual storefronts comprise the building. For example, a property with three tenants will not be considered three individual projects with the ability to apply for the maximum storefront improvement amounts for each storefront. 506 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 4 Ineligible improvements include roofs that are not “part of the façade” (i.e. do not face the public way; the portion of mansard roofs, for example, facing street frontage are eligible), non- permanent fixtures, security systems, personal property, interior window coverings, equipment, any improvements not visible from the public right-of-way, improvements above the ground floor of the property, and any improvements deemed to be inconsistent with redevelopment purposes and objectives. Storefront Modernization Program Administration The Program provides participants the opportunity to receive a rebate upon the completion of their approved Project, up to an approved amount, based the maximum amounts set forth in the sections below. Funding Source(s): Projects will be funded through: tax increment financing (TIF) within applicable TIF Districts, and/or Economic Development funds. Rebate/Forgivable Loan: The rebate is in the form of a loan, forgivable over a five (5) year (60 month) period as illustrated in the box to the right. Participants can receive a rebate for up to half of the total project cost, based on the “total eligible cost” for their specific Project. Note: if the agreement is terminated prior to the completion of the five-year (60-month) forgivable loan period, the Participant will be responsible for repayment of the balance of rebate (“loan”) on a prorated basis. The prorated amount due will be determined by multiplying the original rebate amount times the percentage obtained by dividing the number of months remaining in the five (5) year period by 60 (the total number of months in the loan period). The commencement date of the 60 month forgivable period starts on the month that the program agreement is signed and ends on the 5th anniversary date. Targeted Eligibility Level – Total Eligible Project Cost: Properties located within the target area are eligible to receive up to 100% of the cost of exterior improvements up to a maximum amount of $25,000. Basic Eligibility Level - Total Eligible Project Cost: To determine “total eligible cost” for storefront projects, rebates are based on a formula whereby the first thirty-five (35) linear feet of public right-of-way facing frontage (or less) is eligible for up to $10,000 on a 50/50 cost-sharing basis. Each linear foot of frontage greater than thirty-five (35) is eligible for an additional $100 per foot toward the “total eligible cost”. In order to calculate the “total eligible cost,” measurements of the façade should be taken from one end of a structure to another end of the structure that includes only the portion(s) of the storefront for which funds are being requested for assistance. FIVE (5) YEAR FORGIVEABLE LOAN Example Improvement: Total Project Cost: $ 50,000 Eligible Rebate: $ 13,500 Owner/Tenant Funds: $ 36,500 Total Forgivable Loan from the City: $ 13,500 Month 0-12 Loan ($2,700): $ 10,800 Month 13-24 Loan ($2,700): $ 8,100 Month 25-36 Loan ($2,700): $ 5,400 Month 37-48 Loan ($2,700): $ 2,700 Month 49-60 Loan ($2,700): $ 0 507 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 5 For example, if the public right-of-way facing portion of a storefront is seventy (70) linear feet, the first thirty-five (35) linear feet of the façade would be eligible for up to $10,000 in funding, based on the 50/50 cost sharing provision. The remaining thirty-five linear feet qualify the applicant for an additional $3,500 in assistance. In total, this storefront would qualify for up to $13,500 in assistance. Note, a storefront is considered the entire length of the building that faces the street, regardless of how many individual storefronts comprise the building. If a structure contains three individual commercial spaces with three tenants, this property will not be considered as three individual projects with the ability to apply for the maximum storefront improvement amounts for each individual commercial tenant’s storefront; the maximum eligibility amount will be determined based on the length of frontage. For any approved projects (basic or targeted) for which a rebate of $10,000 or more is awarded, an applicant may request up to two payments for the project. In such cases, a schedule for the partial payment and a timeline with benchmarks for completion for each project phase must be submitted and approved by Economic Development Staff. In each case, the reimbursement shall only be made after the defined work has been completed and passed any necessary inspections, and payment has been made by the business/property owner. Estimates for the Project: As storefront improvement grants are public funds, Participants will be expected to get three estimates for each aspect of their project, including at least one estimate from an Evanston-based business whenever possible. Program Steps Step 1: Contact the Economic Development Division. Applicants should contact the Economic Development Division to discuss the program, process, and approval timelines: Cindy Plante Economic Development Coordinator (847) 448-8132 cplante@cityofevanston.org Step 2: Application Submission. Applications are reviewed by the Economic Development Committee on the 4th Wednesday of each month. In order to place an application on the committee agenda, it must be submitted by the second Monday of the month. Complete submissions must include the following:  Completed application form (link);  Copies of three estimate sheets for the proposed scope of work. At least one of the three estimates must come from an Evanston based business.  Two (2) Color photographs of the property “as is”.  Illustration/Design of proposed work to be completed.  Proof of commercial general liability and auto insurance  If tenant is the applicant, letter of support from property owner indicating he/she is supportive of the project and has reviewed the terms and conditions of the Program. Note: All applications, project photos, and supporting documents shall be submitted online. 508 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 6 Step 3: Staff Application Review Process. After Applications are submitted, Staff will:  Evaluate each project submitted to determine if Application is complete.  Confirm eligibility of proposed project and location and determine total eligible project cost;  Prepare recommendations of approval of funds to the appropriate Committee. Staff will evaluate Applications on the following criteria:  Total project budget;  Location within an established business district, along a major street or near a transit station;  Use of energy efficiency measures (installation of energy saving windows, doors, etc.);  Steps taken to improve access for persons with disabilities;  Returning unproductive uses to productive uses and/or creation of new rentable space in a building;  Investment or tenant improvements being provided by the property owner; and  Total linear feet and/or square footage of commercial space to be improved. Step 4: Public Review and Approval Process. Staff will submit recommendations to the Economic Development Committee for review and recommendation to City Council. All projects are then forwarded to City Council for final approval. Participants whose total project costs exceed $3,000 are required to be present at all public meetings at which proposed Project will be discussed. Participants will be notified of time, date, and place of the public meeting at which the Application will be considered. Staff will outline meeting schedules for applicants at their consultation meetings. Step 5: Execution of Program Agreement. Following approval by City Council, Participants will be required to enter into and execute a written agreement with the City of Evanston which will establish the terms, conditions, and requirements for participation in the Program. Once the Program Agreement has been executed to the satisfaction of the City Manager, a Notice to Proceed will be issued to the Participant. Note: Projects must be completed within 180 business days of the applicant being provided the Notice to Proceed in order to obtain funding. Step 6 (if applicable): Project Phasing Plan. Applicants that have been approved for projects with a rebate of $10,000 or more may submit to Economic Development Staff a written request to divide projects into two phases for the purposes of partial reimbursement of project costs. For example, if a project includes multiple components such as tuck-pointing, window and door replacement and signage, applicant may propose to staff to divide work into two phases in order to seek repayment after certain aspects of the project have been completed. Applicants shall submit to Economic Development staff a project phasing plan, which clearly defines the work to be completed in each phase along with expected completion dates. Such phasing plan must be approved by Staff in order to establish partial payment plan. Step 7: Submit Receipts & Proof of Payment: Upon completion of the project, submit receipts and proof of payment to the Economic Development Division for reimbursement. 509 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 7 Note: Commencement of work without an executed Program Agreement will automatically disqualify a Participant from being eligible to participate in the Program, and negates the City’s obligation to rebate any portion of the work. 510 of 549 City of Evanston – Storefront Modernization Program Agreement P a g e | 8 Terms & Conditions In accordance with the Program Guidelines, the City of Evanston will provide financial assistance up to the approved amount of a project. The rebate will come in the form of a loan forgivable over a five (5) year (or 60 month) period, upon completion of the Project. Any rebates paid by the City of Evanston pursuant to this program shall not be made until all work has been completed; all improvement work has been inspected and approved by the City of Evanston. If a partial rebate payment schedule with project completion benchmarks has been established with and approved by Economic Development Staff (for projects eligible for $10,000 or more), work must still be inspected and approved by the City prior to partial payment being issued. Additionally, all payments for said work must be made to contractors, material suppliers, and vendors. Participants of the Program must submit to the City of Evanston itemized invoices detailing work completed and materials purchased. Such invoices shall include proof of payment to all contractors, suppliers, and vendors. Documentation must be submitted within 45 days of project completion. The participant shall also submit unconditional lien releases and other documentation as required by this Program. The participant is responsible for all payments to all contractors, material suppliers, and vendors. Any rebates paid by the City of Evanston pursuant to this Program constitute loans made to the Participants. Said loans will be forgiven, as described in the Program Agreement, however, if the property owner or successor-in-interest assumes the Participant’s obligations of the Program Agreement pursuant to a City-approved assignment and assumption agreement, and continues to own and/or occupy the rehabilitated property and maintain the improvements for a period ending five (5) years from the date the program agreement is signed without removing or significantly altering the Improvements, as determined by the City of Evanston in its sole discretion. If the property owner sells the property or the business owner fails to occupy the property prior to the end of the fifth (5th) year, the remaining share of the loan (prorated on a monthly basis) shall become due, plus three percent (3%) interest per annum payable to the City of Evanston is due within thirty (30) calendar days, unless the succeeding property owner or business owner (i) assumes the obligations of the Program Agreement pursuant to a City of Evanston approved assignment and assumption agreement, and (ii) does not make any changes to the property resulting in the removal of significant alteration to the Improvements, and maintains the Improvements for a period of five (5) years from the date of receipt of the rebate. The prorated amount due will be obtained by multiplying the original rebate amount times the percentage obtained by dividing the number of months remaining in the five (5) year period that commences on the month that the program agreement is signed and ends on the 5th anniversary date by 60, which is the total number of months in the loan period. Project Completion: Projects must be completed within 180 business days of receiving the Notice to Proceed by the City as specified in Section VI of the Program Agreement (extensions will be considered on a case-by-case basis); Property Taxes and Liens: Property taxes must be current, and participants may have no debts in arrears to the City when the Commitment Letter is issued. The property must also be clear of all other non-debt related liens. 511 of 549 For City Council Meeting of February 12, 2018 Item O2 Business of the City by Motion: Storefront Modernization – 525 Kedzie For Action To: Honorable Mayor and Members of the City Council From: Paul Zalmezak, Economic Development Division Manager Cindy Plante, Economic Development Coordinator Subject: Storefront Modernization Program Application for Linmay Studio at 525 Kedzie Street Date: February 1, 2018 Recommended Action: Staff and Economic Development Committee recommend approval of financial assistance on a 50/50 cost-sharing basis through the Storefront Modernization Program to Linmay Studio at 525 Kedzie Street in an amount not to exceed $696.66 for improved signage. Funding Source: Funding will be from the Economic Development Business District Improvement Fund (Account 100.21.5300.65522). The approved Fiscal Year 2018 Budget allocated a total of $250,000 for this account to fund both the Storefront Modernization and Great Merchant Grant programs. To date, $0 has been spent from this account, leaving $250,000 available for expenditure. Livability Benefit: Economy and Jobs: retain and expand local businesses Built Environment: enhance public spaces Background: The Storefront Modernization Program provides a financial incentive to property owners and their commercial tenants to invest in improvements to commercial property in Evanston. Eligible expenses include street-facing exterior improvements such as windows, doors, signage, painting, and the like. Maximum eligibility amounts for façade projects are determined based on the building’s frontage, with the first 35 feet of linear frontage eligible for a maximum of $10,000; frontage beyond 35 feet increases eligibility by $100 for each additional square foot up to a $25,000 cap. Applicants are eligible to receive a forgivable loan of up to 50% of the total qualifying project cost, and must obtain three written bids for the work proposed, with at least one of the three bids being provided by an Evanston-based contractor whenever possible. The program is intended to help modernize aging building stock in targeted development areas and Memorandum 512 of 549 improve the aesthetics individual commercial businesses within their respective business districts. (For more detailed information, please refer to the Program Guidelines online.) Summary: Linmay Studio is a hair salon moving into street-level space at 525 Kedzie Street. The business owner is seeking assistance with fabrication and installation of a sign that will improve visibility from Chicago Avenue. The proposed signage consists of white acrylic lettering to be installed on the brick wall that fronts on Chicago Avenue. The space has less than 35 linear feet of frontage, making the property eligible for a maximum of $10,000 in funding assistance. The applicant has submitted three bids for the proposed scope of work, including at least one from an Evanston-based contractor as required under the program guidelines. The estimates provided are summarized below: Sign Estimates Chicago Sign Systems 4200 W. Diversey Ave. #31 Chicago, IL 60639 $2,200 FastSigns Lincolnwood (in partnership with Evanston Signs) 3450 W. Devon Ave. Lincolnwood, IL 60712 $827 Impact Signs 505 N. Lake Shore Dr., Unit 1703 Chicago, IL 60611 $1,153 Average: $1,393.33 The average of the three estimates submitted for the proposed sign work was $1,393. Based on the documentation and bids submitted for this project, staff recommends approval of financial assistance for this project for a total amount not to exceed the maximum of $696.66 on a 50/50 cost-sharing basis. Attachments: Storefront Modernization Program Application for Linmay Studio at 525 Kedzie Proposed sign rendering Contractor Bids 513 of 549 12/15/2017 CITY OF EVANSTON Mail - 2018 Storefront Modernization Program [#26] https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=gNJGSxrCYso.en.&view=pt&msg=160560511139ad29&search=inbox&siml=160560511…1/2 Cindy Plante <cplante@cityofevanston.org> 2018 Storefront Modernization Program [#26] Wufoo <no-reply@wufoo.com>Thu, Dec 14, 2017 at 11:14 AM Reply-To: linmaystudio@gmail.com To: cplante@cityofevanston.org Property Address * 525 Kedzie Street Property PIN *525? Year Property was constructed 10+ years Length of store frontage (feet): *6 Is this property a historic landmark?No Applicant Name: *Lindsay Mayuga Applicant Address: *4835 N Damen Ave #2S, Chicago IL 60625 Email *linmaystudio@gmail.com Phone Number (773) 710-4799 Name of business (if applicable):Linmay Studio Applicant is: *Tenant Name(s) of business(es):Linmay Studio Business Owner Name(s):Lindsay Mayuga Date of lease expiration (if applicable):12/01/2022 How many years has the business been at this location? 0 Provide a description of the ground floor business(es) at this location (500 words max). Modern hair studio, nestled into 525 Kedzie. Property Owner Name:Kate Varde Property Owner Address: 2211 N. Elston Ave., Suite 302 | Chicago, IL 60614 Property Owner Phone Number:(773) 305-4908 Property Owner Email:katevarde@essexrealtygroup.com Is the property currently for sale?No What type(s) of improvements are you planning to make? (check all that apply) * Signage/awnings Provide a narrative of your proposed project. Include information on portions of White acrylic lettering with Linmay Studio logo. Float on the brick wall. 514 of 549 12/15/2017 CITY OF EVANSTON Mail - 2018 Storefront Modernization Program [#26] https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=gNJGSxrCYso.en.&view=pt&msg=160560511139ad29&search=inbox&siml=160560511…2/2 the building that will be improved and what particular work activities will be completed. (500 words max) * Provide a narrative of sustainability measures that will be employed in this project (500 words max) The sign will be drilled into the concrete grout on the building. Provide a narrative of how your proposed project will improve accessibility at your building (500 words max) My space is nestled into the side of the building. The sign I am proposing will allow visibility from Chicago Avenue, the main street my customers will be accessing my location from. Upload 3 current photos of the building for which you are applying. img_7157.png 956.34 KB · PNG img_7230.jpg 2.10 MB · JPG img_7232.jpg 1.82 MB · JPG Upload 3 contractor estimates for the project(s) being proposed. image1.jpg 114.22 KB · JPG img_7281.png 143.85 KB · PNG preview_attachment_estimate.pdfestimate.pdf77_kb.webloc 351 B · UNKNOWN If applicant is not the owner of the building for which funding is sought, upload a letter of support from the property owner. unnamed.jpg 89.61 KB · JPG "I certify that all of the information contained in this document, all statements, information, and exhibits that I am submitting for the property listed in this form under 'property information' is true and accurate and to the best of my knowledge. I certify that I have reviewed the Program Guidelines and Program Agreement form associated with the City of Evanston's Facade Improvement Program." (Type name below for signature). * Lindsay Mayuga Date *Thursday, December 14, 2017 515 of 549 516 of 549 517 of 549 1/11/2018 CITY OF EVANSTON Mail - Fwd: Impact Signs Quote Request - Linmay Studio https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=pkG7biCEwPU.en.&view=pt&search=inbox&th=160e5d4e489291ad&siml=160e5d4e48…1/3 Cindy Plante <cplante@cityofevanston.org> Fwd: Impact Signs Quote Request - Linmay Studio 1 message Lindsay Mayuga <linmaystudio@gmail.com>Thu, Jan 11, 2018 at 9:26 AM To: "cplante@cityofevanston.org" <cplante@cityofevanston.org> One of my quotes ---------- Forwarded message --------- From: Shabbir Moosabhoy <portal@impactsigns.com> Date: Tue, Dec 12, 2017 at 10:40 AM Subject: Re: Impact Signs Quote Request - Linmay Studio To: <Linmaystudio@gmail.com> ##- Please type your reply above this line -## Hello Lindsay, Thanks for your quote request for a cut metal logo sign. Here is a proposal for your project: Overall 42" wide, height to scale from logo 1/4" thick solid aluminum, painted white Includes stud mounts, installation template and Spacers to "float" your letters. Sign price = $1153 See these examples: https://goo.gl/PRDJPc Typical lead time is about 3 weeks production time. (After proof approval and payment in full) Did you need the order by a specific date? In many cases we can meet rush deadlines with a rush production fee and expedited shipping (Please do not plan your event without confirmation that we can meet your in-hand date) Need a shipping estimate? Please provide your complete street address. We can also discuss more cost effective options: Acrylic with metal laminate (about 75% of the price) https://goo.gl/AXcHyN https://goo.gl/GR8KdQ https://goo.gl/hmujZq Painted acrylic (about 65% of the price) https://goo.gl/IntMwm https://goo.gl/wOZdqi Or adding the metal logo to a glass, metal, or acrylic panel (ask for a quote) Are you ready to order? We’ll send you an invoice link for a $250 deposit. **Deposit is non-refundable if you decide to not proceed with the production Once we receive the deposit payment, we’ll begin your proof. (Typically 2-3 business days) In the proof phase, we can adjust size, details and layout as needed. 518 of 549 1/11/2018 CITY OF EVANSTON Mail - Fwd: Impact Signs Quote Request - Linmay Studio https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=pkG7biCEwPU.en.&view=pt&search=inbox&th=160e5d4e489291ad&siml=160e5d4e48…2/3 Please let me know your thoughts, and I look forward to working with you very soon! Regards, Shabbir Moosabhoy 708-469-7178 shabbir@impactsigns.com Submitted Form Details below: Date Submitted: 10:22 AM Client Name: Lindsay Mayuga Company: Linmay Studio Email: Linmaystudio@gmail.com Phone: (773) 710-4799 Internal Notes: White 1/2” acrylic letter. Quote with instillation. Overall Size: 20” x 42” Files: EF8F92B8-7233-4874-8921-084F209AC19E.png Source: (direct) Medium: (none) Term: - Campaign: (direct) Embed URL: http://www.impactsignschicago.com/ *Note, if you are sending us images please send them as individual attachments (no inline/embedded images please) 519 of 549 Estimate Printed: 80- 32616 Page 1 of 2 12/12/2017 5:08:21PM FASTSIGNS LINCOLNWOOD 3450 W.DEVON AVE. LINCOLNWOOD, IL 60712 ph: (847)675-1600 (847)675-1614fax: Email: 80@fastsigns.com Estimate Date:12/12/2017 5:05:45PM Customer:ph: Lindsay Mayuga email: (847) 675-1600 Contact: lindsay.mayuga@gmail.com Mayuga, Lindsay Sales Person: Dawn Schram Clerk: Elizabeth O'Connor Description: Customer: 12986 EXTERIOR ARCHITECTURAL LETTERING, INSTALLED (NEW SIZE) Dear Lindsay: Thank you for considering FASTSIGNS LINCOLNWOOD for your sign needs. The quotation you requested is attached below. If you have any questions, please don't hesitate to call us at 847-675-1600. TO PROCEED AND PLACE YOUR ORDER: -Carefully Review All Details of This Estimate -Sign and Date The Estimate (Lower Right Hand Corner) -Complete Credit Card Authorization Form (If Applicable) -Fax or E-Mail Your Signed Estimate and Credit Card Authorization Form ORDER AGREEMENT TERMS: A. ARTWORK: All sign prices quoted are based on CUSTOMER PROVIDED "PREPARED ARTWORK". Any artwork creation, recreation, or modification will incur itemized DESIGN fees. B. PROOFS: Will be completed the business day after an order is placed and must be approved prior to production. NOTE: ONCE A PROOF HAS BEEN PROVIDED (PRIOR TO PRODUCTION) CANCELLED ORDERS ARE SUBJECT TO MINIMUM CANCELLATION FEE OF $50.00 OR APPLICABLE DESIGN FEES. C. FASTSIGNS PROOF POLICY: Fastsigns provides up to (2) sign proofs ("First Proof" and a "Revised Proof"-only if necessary) for your approval prior to actually manufacturing your custom made sign. If the "Revised Proof" contains any errors or omissions by FASTSIGNS, we will provide a "Corrected Revised Proof" at no additional charge. Any customer requested "changes" (after the "Revised Proof") are subject to an additional Proof charge of $15. per additional proof. D. STANDARD IN HOUSE PRODUCTION TIME: Completion by 4pm the business day following approved proofs. NOTE: ONCE PROOFS ARE APPROVED, YOU ARE RESPONSIBLE FOR 100% OF THE ORDER TOTAL SHOULD ANY CHANGES BECOME NECESSARY AFTER PRODUCTION BEGINS E. COMPLETED SIGNS: ARE PAYABLE IN FULL AND ARE NON-REFUNDABLE F. CUSTOM SIGN ORDER MINIMUM: $50. Plus Applicable Sales Tax -SHIPPING/HANDLING CHARGES (if Applicable) Will Be Added To the Invoice upon Completion -Prices Honored Up to 30 Days from Date of Original Estimate -HOURS: M-F 8:30 AM - 5:00PM CLOSED SAT. AND SUN. E-MAILING ARTWORK: For large file transfers (over 4 MB), please go to http://www.fastsigns.com/US-IL-Lincolnwood-store80.html and click on "Send a File" or fastsigns.com/80 Sincerely, Dawn Schram E-mail us your files at 80@fastsigns.com SYSTEM\FASTSIGNS_CRYSTAL_Estimate01 520 of 549 Estimate Printed: 80- 32616 Page 2 of 2 12/12/2017 5:08:21PM FASTSIGNS LINCOLNWOOD 3450 W.DEVON AVE. LINCOLNWOOD, IL 60712 ph: (847)675-1600 (847)675-1614fax: Email: 80@fastsigns.com Estimate Date:12/12/2017 5:05:45PM Product Qty Sides H x W Unit Cost Totals 1 1 19.53 x 42 $513.00 1 $513.00 Architectural Letters Description:Custom Architectural Letters = 1/2" THICK ACRYLIC WhiteColor: 1 1 0 x 0 $265.00 2 $265.00 INSTALL-SIGNS * Description:LOCATION: BUILDING EXTERIOR SURFACE: BRICK HEIGHT: APPROX 5' FROM GROUND ADDRESS: 525 KEDZIE EVANSTON IL 60202 ON SITE CONTACT: TBD CHARGES ARE BASED ON ONE TRIP INSTALLATIONS DURING REGULAR BUSINESS HOURS (M-F 8:30 AM-5:00 PM) UNLESS OTHERWISE NOTED. MULTIPLE TRIP AND AFTER HOURS INSTALLATIONS WILL INCUR ADDITIONAL CHARGES. NOTES: 1) Exterior Installations are "Weather Permitting" and may be rescheduled at our discretion. 2) "Removal" of existing signs/graphics and or adhesive/residue from previous signs/graphics are not included unless noted 3) OBTAINING SIGN PERMITS (IF APPLICABLE) ARE THE RESPONSIBILITY OF THE CUSTOMER Notes: Line Item Total:$778.00 Tax Exempt Amt:$280.00 Subtotal:$778.00 Taxes:$49.80 Total:$827.80 Deposit Required:$413.90 CUSTOM SIGNS ARE NON-REFUNDABLEMayuga, Lindsay 525 Kedzie Evanston, IL 60202 Received/Accepted By: Bill To: Lindsay Mayuga / / E-mail us your files at 80@fastsigns.com SYSTEM\FASTSIGNS_CRYSTAL_Estimate01 521 of 549 Estimate Printed: 80- 32616 Page 1 of 2 12/12/2017 5:08:21PM FASTSIGNS LINCOLNWOOD 3450 W.DEVON AVE. LINCOLNWOOD, IL 60712 ph: (847)675-1600 (847)675-1614fax: Email: 80@fastsigns.com Estimate Date:12/12/2017 5:05:45PM Customer:ph: Lindsay Mayuga email: (847) 675-1600 Contact: lindsay.mayuga@gmail.com Mayuga, Lindsay Sales Person: Dawn Schram Clerk: Elizabeth O'Connor Description: Customer: 12986 EXTERIOR ARCHITECTURAL LETTERING, INSTALLED (NEW SIZE) Dear Lindsay: Thank you for considering FASTSIGNS LINCOLNWOOD for your sign needs. The quotation you requested is attached below. If you have any questions, please don't hesitate to call us at 847-675-1600. TO PROCEED AND PLACE YOUR ORDER: -Carefully Review All Details of This Estimate -Sign and Date The Estimate (Lower Right Hand Corner) -Complete Credit Card Authorization Form (If Applicable) -Fax or E-Mail Your Signed Estimate and Credit Card Authorization Form ORDER AGREEMENT TERMS: A. ARTWORK: All sign prices quoted are based on CUSTOMER PROVIDED "PREPARED ARTWORK". Any artwork creation, recreation, or modification will incur itemized DESIGN fees. B. PROOFS: Will be completed the business day after an order is placed and must be approved prior to production. NOTE: ONCE A PROOF HAS BEEN PROVIDED (PRIOR TO PRODUCTION) CANCELLED ORDERS ARE SUBJECT TO MINIMUM CANCELLATION FEE OF $50.00 OR APPLICABLE DESIGN FEES. C. FASTSIGNS PROOF POLICY: Fastsigns provides up to (2) sign proofs ("First Proof" and a "Revised Proof"-only if necessary) for your approval prior to actually manufacturing your custom made sign. If the "Revised Proof" contains any errors or omissions by FASTSIGNS, we will provide a "Corrected Revised Proof" at no additional charge. Any customer requested "changes" (after the "Revised Proof") are subject to an additional Proof charge of $15. per additional proof. D. STANDARD IN HOUSE PRODUCTION TIME: Completion by 4pm the business day following approved proofs. NOTE: ONCE PROOFS ARE APPROVED, YOU ARE RESPONSIBLE FOR 100% OF THE ORDER TOTAL SHOULD ANY CHANGES BECOME NECESSARY AFTER PRODUCTION BEGINS E. COMPLETED SIGNS: ARE PAYABLE IN FULL AND ARE NON-REFUNDABLE F. CUSTOM SIGN ORDER MINIMUM: $50. Plus Applicable Sales Tax -SHIPPING/HANDLING CHARGES (if Applicable) Will Be Added To the Invoice upon Completion -Prices Honored Up to 30 Days from Date of Original Estimate -HOURS: M-F 8:30 AM - 5:00PM CLOSED SAT. AND SUN. E-MAILING ARTWORK: For large file transfers (over 4 MB), please go to http://www.fastsigns.com/US-IL-Lincolnwood-store80.html and click on "Send a File" or fastsigns.com/80 Sincerely, Dawn Schram E-mail us your files at 80@fastsigns.com SYSTEM\FASTSIGNS_CRYSTAL_Estimate01 522 of 549 Estimate Printed: 80- 32616 Page 2 of 2 12/12/2017 5:08:21PM FASTSIGNS LINCOLNWOOD 3450 W.DEVON AVE. LINCOLNWOOD, IL 60712 ph: (847)675-1600 (847)675-1614fax: Email: 80@fastsigns.com Estimate Date:12/12/2017 5:05:45PM Product Qty Sides H x W Unit Cost Totals 1 1 19.53 x 42 $513.00 1 $513.00 Architectural Letters Description:Custom Architectural Letters = 1/2" THICK ACRYLIC WhiteColor: 1 1 0 x 0 $265.00 2 $265.00 INSTALL-SIGNS * Description:LOCATION: BUILDING EXTERIOR SURFACE: BRICK HEIGHT: APPROX 5' FROM GROUND ADDRESS: 525 KEDZIE EVANSTON IL 60202 ON SITE CONTACT: TBD CHARGES ARE BASED ON ONE TRIP INSTALLATIONS DURING REGULAR BUSINESS HOURS (M-F 8:30 AM-5:00 PM) UNLESS OTHERWISE NOTED. MULTIPLE TRIP AND AFTER HOURS INSTALLATIONS WILL INCUR ADDITIONAL CHARGES. NOTES: 1) Exterior Installations are "Weather Permitting" and may be rescheduled at our discretion. 2) "Removal" of existing signs/graphics and or adhesive/residue from previous signs/graphics are not included unless noted 3) OBTAINING SIGN PERMITS (IF APPLICABLE) ARE THE RESPONSIBILITY OF THE CUSTOMER Notes: Line Item Total:$778.00 Tax Exempt Amt:$280.00 Subtotal:$778.00 Taxes:$49.80 Total:$827.80 Deposit Required:$413.90 CUSTOM SIGNS ARE NON-REFUNDABLEMayuga, Lindsay 525 Kedzie Evanston, IL 60202 Received/Accepted By: Bill To: Lindsay Mayuga / / E-mail us your files at 80@fastsigns.com SYSTEM\FASTSIGNS_CRYSTAL_Estimate01 523 of 549 1/11/2018 CITY OF EVANSTON Mail - Fwd: Signage.ai https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=pkG7biCEwPU.en.&view=pt&msg=160e5d55dc6dffbc&search=inbox&siml=160e5d55dc…1/2 Cindy Plante <cplante@cityofevanston.org> Fwd: Signage.ai Lindsay Mayuga <linmaystudio@gmail.com>Thu, Jan 11, 2018 at 9:27 AM To: "cplante@cityofevanston.org" <cplante@cityofevanston.org> Quote ---------- Forwarded message --------- From: Phil Schultz <phil@chicagosignsystems.com> Date: Mon, Dec 11, 2017 at 11:05 AM Subject: Re: Signage.ai To: Lindsay Mayuga <linmaystudio@gmail.com> Hi Lindsay, I hope you had a good weekend. I have some pricing here for the wall logo. If we do the logo at size sent. (42" wide) 3/4" thick White Cut Acrylic = $950 + tax. 1" thick Cast Aluminum /White / = $1,650 + tax Either option would be installed with studs behind the letters that get drilled into the concrete. Installation at ground level will cost $550. Prices do not include Permits. Please let me know if you have any questions. Regards, Phil On Dec 7, 2017, at 11:33 AM, Lindsay Mayuga wrote: No rush but thank you!!! On Thu, Dec 7, 2017 at 11:07 AM, Phil Schultz <phil@chicagosignsystems.com> wrote: Hi Lindsay, I am very sorry but this slipped through on me. I will have a quote for you ASAP. Phil Phil Schultz phil@chicagosignsystems.com On Dec 7, 2017, at 10:04 AM, Lindsay Mayuga <linmaystudio@gmail.com> wrote: 524 of 549 1/11/2018 CITY OF EVANSTON Mail - Fwd: Signage.ai https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=pkG7biCEwPU.en.&view=pt&msg=160e5d55dc6dffbc&search=inbox&siml=160e5d55dc…2/2 Hey Phil, Following up on the quote. Thank you, Lindsay On Thu, Nov 30, 2017 at 10:32 PM Lindsay Mayuga <linmaystudio@gmail.com> wrote: I have not checked with the permitting because I am going to be a part of a city program where I get half my sign reimbursed. I will check with my landlord Plastic I believe because I want white? But maybe you do white aluminum. The smaller is door yes! Also depending on the price I may skip the program and do it on my own, so I will look into permits. On Thu, Nov 30, 2017 at 8:03 PM Phil Schultz <phil@chicagosignsystems.com> wrote: Perfect! I have a couple of questions. Have you checked in with the village to see about a permit for your sign? Also, I would recommend getting approval from your landlord. Would you like me to quote Aluminum letters or Plastic? Is the smaller graphic going to be for the door? Phil On Nov 30, 2017, at 2:41 PM, Lindsay Mayuga wrote: Is this what you need? ---------- Forwarded message --------- From: Lindsay Mayuga <lindsay.mayuga@gmail.com> Date: Thu, Nov 30, 2017 at 2:41 PM Subject: Signage.ai To: <linmaystudio@gmail.com> Sent from my iPhone <Signage.ai> 525 of 549 526 of 549 527 of 549 For City Council Meeting of February 12, 2018 Item O3 Business of the City by Motion: Entrepreneurship Program – Lashing Out! For Action To: Honorable Mayor and Members of the City Council From: Paul Zalmezak, Economic Development Division Manager Cindy Plante, Economic Development Coordinator Subject: Entrepreneurship Support Program Application – Lashing Out! Date: February 1, 2018 Recommended Action: Staff and Economic Development Committee recommend approval of financial assistance through the Entrepreneurship Support Program for up to $1,000 in assistance with City permitting and licensing and up to $2,500 for equipment, work space, and certifications for Lashing Out. Funding Source: Funding will be from the Economic Development Business Retention/Expansion Fund (Account 100.21.5300.62662). The approved Fiscal Year 2018 Budget allocated a total of $150,000 for this account. To date, $1,800 has been spent or encumbered from the account, leaving $148,200 available for expenditure. Livability Benefit: Economy and Jobs: retain and expand local businesses, develop workforce, and expand job opportunities Equity and Empowerment: support poverty prevention and alleviation Background: The Entrepreneurship Support Program was created to provide limited one-time grant assistance to individuals starting or expanding a small business in Evanston. The program guidelines were approved by City Council in April, 2017 after consultation with the Minority, Women, and Evanston-Based Enterprise Committee (M/W/EBE Committee), Sunshine Enterprises, and LEND. The program guidelines provide for up to $1,000 in assistance with City licensing and permitting fees (to be provided by an interfund transfer from economic development rather than a fee waiver) and/or up to $2,500 in assistance for qualifying business expenses such as tools, equipment, insurance, professional services, training, certifications, and production space. Such payments are to be made directly to vendors and service providers. Applicants must provide three estimates for services to be funded (when possible) and must submit a Memorandum 528 of 549 detailed business plan as part of the application, and poof of either residence in Evanston or a business location in Evanston. Businesses receiving funding through this program are not barred from seeking funding through the Storefront Modernization Program in the event that they open a brick and mortar location in Evanston, though each program must be applied for separately. For more detailed information, please refer to the attached Program Guidelines. Summary: Owner Alicia Skipworth intends to open Lashing Out in the retail space fronting Spex Hand Car Wash at 1235 Dodge. The salon will offer skincare, eyelash, brow, and nail services. Ms. Skipworth has completed Sunshine Community Business Academy and is also working with LEND at Northwestern for a loan and technical assistance. Ms. Skipworth’s entrepreneurship support program funding request for the maximum amount of $2,500 will help cover costs associated with renting the space, completing certification classes, and purchase of equipment such as pedicure bowls and manicure tables. Approval is also requested for up to the $1,000 maximum amount of assistance available for City permitting, licensing and inspection fees. Estimates have been provided for the cost of certification classes as well as equipment including manicure tables, pedicure bowls, chairs, and pedicure stools. The property owner requires an $1,800 deposit to rent the space, which is currently the applicant’s top priority for funding, followed by certifications and equipment. Attachments: Entrepreneurship Support Program Guidelines Lashing Out Application & Business Plan 529 of 549 Entrepreneurship Support Program Application Instructions & Guidelines 2017 City Manager’s Office Economic Development Division 2100 Ridge Avenue, Evanston, Illinois 60201 847.448.8132 cplante@cityofevanston.org 530 of 549 Program purpose & overview The purpose of the small business support grant program is to assist in the growth of jobs in Evanston through entrepreneurship, helping residents and local business owners to create jobs by starting sustainable small businesses. To that end, this program aims to provide key supports during startup and initial growth stages to local entrepreneurs with viable business models. Funding Source: Projects will be funded through the Economic Development Revenues and any applicable TIF districts. Program expenses must be budgeted by the City each year, and will not carryover from year to year. In addition to required applicant eligibility qualifications, assistance under this Program depends upon availability of funds. Eligibility Criteria Applicants meeting eligibility criteria who are starting or operating a business with a physical location in Evanston are eligible for grant-based assistance through this Program. All applicants must submit a business plan conforming to minimum Program standards* and reasonably demonstrating business viability as determined at the discretion of Program staff. Home-based businesses qualify if the business owner is an Evanston resident. Non-residents are eligible only if operating a business at a physical location in Evanston, and must provide documentation of the business address through ownership, registration, or lease documentation which identifies the applicant specifically. In addition to a business plan, completed applications must include three quotes for each service or expense for which funding assistance is requested, including at least one quote from an Evanston-based provider whenever possible. If granted, assistance will be provided in the form of direct payments made for services or other applicable supports. Applicants will not receive cash payments. *Business plan must include information substantially similar to one of the included references and must demonstrate commercial viability as determined at the discretion of Program staff. Applicants must have no outstanding parking tickets and be current on all fees, taxes, utility bills and debts owed to the City of Evanston. Participation in this Program does not disqualify an applicant or business with a brick-and-mortar location from also participating in the Storefront Modernization Program. Ineligible applicants include:  Applicants with one or more outstanding parking tickets or who are not current on fines, fees, taxes, or utility bills due to the City of Evanston  Applicants who have received Entrepreneurship Support Program funding from the City of Evanston within the past five years  Businesses that are part of a franchise operation with more than 10 locations within or outside of Evanston  Churches or other religious organizations 531 of 549  Government offices or agencies  Nonprofit organizations Eligible Services Eligible applicants may: I. Request up to $1,000 in assistance with City permitting and licensing needs, including food establishment licenses, general business licenses, building and sign permits, or inspections; and/or II. Request up to $2,500 of small business support grant funding for expenses or services in the following categories: 1. Professional Services (Accounting, tax, insurance, legal) 2. Tools and Equipment (software, hardware, process-specific tools or equipment) 3. Licenses and Certifications 4. Production and Work Space 5. Continued research and development of initial MVPs (minimum viable products) 6. Continuing Education and Key Personnel Development (Classes, workshops, training programs) 7. Professional and Market Networks Program Administration & Application Process Step 1: Submit online application (first Monday of the month). All grant applications must be completed and submitted online: https://cityofevanston.wufoo.com/forms/entrepreneurship-support-program-application/. Applications are considered on a rolling basis throughout the year and must be reviewed by the Economic Development Committee, which meets on the fourth Wednesday of each month. In order to ensure your place on the committee agenda, completed applications must be turned in no later than the second Monday of the month in which review is requested. Complete applications must include:  business plan  three estimates for each service or purchase to be funded, including one estimate from an Evanston provider whenever possible  proof of residency or business location in Evanston 532 of 549 Step 2: Staff application review process (10 business days). Staff will review applications for compliance with eligibility guidelines and scope of work to be funded. LEND will assist with business plan review and assessment. Step 3: Public Review & Approval Process (fourth Wednesday of the month). Staff will submit the completed Entrepreneurship Support Program applications and bids to the Economic Development Committee and City Council for approval. Applicants are encouraged to attend all public meetings during which their applications are being considered. Step 4: Execute a program agreement. Following approval by City Council, successful applicants must sign a Program agreement acknowledging the terms and obligations of their participation. . 533 of 549 1/24/2018 CITY OF EVANSTON Mail - Entrepreneurship Support Program Application [#12] https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=2WGmGQ4tSfE.en.&view=pt&msg=16124fdb4e621970&search=inbox&siml=16124fdb4…1/2 Cindy Plante <cplante@cityofevanston.org> Entrepreneurship Support Program Application [#12] Wufoo <no-reply@wufoo.com>Tue, Jan 23, 2018 at 3:47 PM Reply-To: no-reply@wufoo.com To: cplante@cityofevanston.org Applicant Name *Alicia Skipworth Applicant Address *1810 Dodge Ave Apt 2 Evanston, IL 60201 United States Applicant Email *aliciaskipworth@yahoo.com Applicant Phone Number *7733120209 Business Name *Lashing Out! Please provide a description of your business (500 words max) Lashing Out! will be an upscale lash/nail salon located in the Evanston area. Our line of services will include mink, strip and individual cluster lash applications. We will also offer skin care services such as waxing, facials, makeup application, eyebrow fills, tinting and arching. In addition, nail services will also be rendered, which include acrylic, gel and overlays, silk wraps, polish changes, no-chip manicures, dip manicures and pedicures. To appeal to this specific demographic, we will also sell small retail items such as jewelry, lash/nail and makeup accessories – this will be driven by customer demand. While customers want to look nice and be pampered, they are willing to pay others to do it. Lashing Out!’s services will be provided by qualified nail and lash technicians and licensed estheticians who will use uniform quality products, that will be purchased via the internet. Our target customer will be women between the ages of 15-60; however, we will also strategically target professional men between the ages of 21-50 who like to keep their nails and feet groomed. The common thread amongst these demographics are people that take pride in their appearance and are okay with paying for quality services. Often, customers want to enhance their natural beauty and will commit to a weekly or bi-weekly regimen to make sure they are looking their best at all times. I want our customers to feel that they are getting professional, quality service, for an affordable price – Lashing Out!’s emphasis will be on quality over quantity. Our main competitors are other nail, lash salons and spas that offer similar services. The length of time in business, market share and location may be key strengths, however, from personal experience, I’ve seen many salons that are too focused on quantity and not quality. Moreover, most often, customer choices are limited and customers don’t have much say on the products that are ultimately used on them – some of which can be hazardous. At Lashing Out! we will only utilize products, services and tools that are specifically designed to carry out certain tasks. Moreover, we will provide niche’s in the way we offer our services to differentiate ourselves from the competition. We will offer healthy snack options including fruit and infused water to customers while they are receiving services. Furthermore, we will adopt the moniker “beauty from the inside out,” to facilitate and encourage healthy intake in working in close conjunction with external beauty. Lashing Out! will be located in Evanston and will be one of the few minority owned businesses of its kind. I will be responsible for primarily running the business with help from the co-owner. I am looking to employ independent contractors who will operate off commission. The salon will provide the inventory to ensure each contractor is using 534 of 549 1/24/2018 CITY OF EVANSTON Mail - Entrepreneurship Support Program Application [#12] https://mail.google.com/mail/u/0/?ui=2&ik=2e1c0d87b2&jsver=2WGmGQ4tSfE.en.&view=pt&msg=16124fdb4e621970&search=inbox&siml=16124fdb4…2/2 consistent products. I will solicit up to four nail techs and up to four lash artists/estheticians (or a combination thereof) to work agreed upon hours throughout the week and on weekends. Services to be funded:Tools/Equipment Licenses/certifications Production & Work Space Continuing Education Do you need financial assistance with City licensing or permitting requirements? Yes (please specify below): Please describe how you intend to use Entrepreneurship Support Program funding to expand your business (500 words max) I intend to the Entrepreneurship Support Program funding to obtain an eyelash and nail application certificate and/or to purchase material (equipment) for my salon. In addition, if feasible, I would like to use the money to secure the location I'm looking to obtain at 1235 Dempster St in Evanston (Dempster and Dodge). If I could use the money towards the $1800 deposit (which would be ideal), I could use any leftover for training certificates or business licenses. Upload business plan (.pdf or .doc) *entrepreneurship_grant_document.docx 1.32 MB · DOCX Upload proof of completion of a business training program (Community Business Academy or other) * proof_of_completion_for_sunshine_enterprises_ community_business_academy.docx 12.51 KB · DOCX "I certify that all of the information contained in this document, all statements, information, and exhibits that I am submitting is true and accurate and to the best of my knowledge. I certify that I have reviewed the Program Guidelines associated with the City of Evanston's Entrepreneurship Support Program." (Type name below for signature). Alicia Skipworth Date Tuesday, January 23, 2018 535 of 549 1/5/2018 Wufoo · Entry Manager https://cityofevanston.wufoo.com/entries/entrepreneurship-support-program-application/1/2 #9Entrepreneurship Support Program Application Applicant Name *Alicia Skipworth Applicant Address *1810 Dodge St Apt. 2 Evanston, IL 60201 United States Applicant Email *aliciaskipworth@yahoo.com Applicant Phone Number *8472172096 Business Name *Lashing Out!...beauty in the blink of an eye Business Address Please provide a description of your business (500 words max) Lashing Out! will be an upscale lash/nail salon located in the Evanston area. Our line of services will include mink, strip and individual cluster lash applications. We will also offer skin care services such as waxing, facials, makeup application, eyebrow fills, tinting and arching. In addition, nail services will also be rendered, which include acrylic, gel and overlays, silk wraps, polish changes, no-chip manicures, dip manicures and pedicures. To appeal to this specific demographic, we will also sell small retail items such as jewelry, lash/nail and makeup accessories – this will be driven by customer demand. Services to be funded:Professional Services Tools/Equipment Licenses/certifications Continuing Education Professional and Market Networks Do you need financial assistance with City licensing or permitting requirements? Yes (please specify below): Yes, I would like to request funding assistance in obtaining the necessary permits and licensure. Please describe how you intend to use Entrepreneurship Support Program funding to expand your business (500 words max) Upload written estimates for the services needed below: lashing_out___beauty_in_the_blink_of_an_eye_2016workingco… 17.43 KB · XLSX estimates_of_costs__classes.docx 933.52 KB · DOCX Upload business plan (.pdf or .doc) *lashing_out__executive_summary__final.docx 26.49 KB · DOCX 536 of 549 1/5/2018 Wufoo · Entry Manager https://cityofevanston.wufoo.com/entries/entrepreneurship-support-program-application/2/2 Upload proof of residency or business location (lease, utility bill, bank statement, etc.) Upload proof of completion of a business training program (Community Business Academy or other) * "I certify that all of the information contained in this document, all statements, information, and exhibits that I am submitting is true and accurate and to the best of my knowledge. I certify that I have reviewed the Program Guidelines associated with the City of Evanston's Entrepreneurship Support Program." (Type name below for signature). Alicia Skipworth Date Wednesday, July 5, 2017 Created 5 Jul 2017 1:44:05 PM PUBLIC 173.119.29.195 IP Address 537 of 549 ...beauty in the blink of an eye Executive Summary Lashing Out! will be an upscale lash/nail salon located in the Evanston area. Our line of services will include mink, strip and individual cluster lash applications. We will also offer skin care services such as waxing, facials, makeup application, eyebrow fills, tinting and arching. In addition, nail services will also be rendered, which include acrylic, gel and overlays, silk wraps, polish changes, no-chip manicures, dip manicures and pedicures. To appeal to this specific demographic, we will also sell small retail items such as jewelry, lash/nail and makeup accessories – this will be driven by customer demand. With the emergence of YouTube, consumers are becoming more and more self-sufficient, however, as a consumer,1 I understand that while customers want to look nice and be pampered, they are willing to pay others to do it. Lashing Out!’s services will be provided by qualified nail and lash technicians and licensed estheticians who will use uniform quality products, that will be purchased via the internet. Our target customer will be women between the ages of 15-60; however, we will also strategically target professional men between the ages of 21-50 who like to keep their nails and feet groomed. The common thread amongst these demographics are people that take pride in their appearance and are okay with paying for quality services. Often, customers want to enhance their natural beauty and will commit to a weekly or bi-weekly regimen to make sure they are looking their best at all times. I want our customers to feel that they are getting professional, quality service, for an affordable price – Lashing Out!’s emphasis will be on quality over quantity. Our main competitors are other nail, lash salons and spas that offer similar services. The length of time in business, market share and location may be key strengths, however, from personal experience, I’ve seen many salons that are too focused on quantity and not quality. Moreover, most often, customer choices are limited and customers don’t have much say on the products that are ultimately used on them – some of which can be hazardous. At Lashing Out! we will only utilize products, services and tools that are specifically designed to carry out certain tasks. Moreover, we will provide niche’s in the way we offer our services to differentiate ourselves from the competition. We will offer healthy snack options including fruit and infused water to customers while they are receiving services. Furthermore, we will adopt the moniker “beauty from the inside out,” to facilitate and encourage healthy intake in working in close conjunction with external beauty. Lashing Out! will be located in Evanston and will be one of the few minority owned businesses of its kind. I will be responsible for primarily running the business with help from the co-owner. 538 of 549 I am looking to employ independent contractors who will operate off commission. The salon will provide the inventory to ensure each contractor is using consistent products. I will solicit up to four nail techs and up to four lash artists/estheticians (or a combination thereof) to work agreed upon hours throughout the week and on weekends. I will market the business using social media, old fashion signs, local news bulletins and websites such as Groupon. I will also look to partner with other entities to co-promote the business such as smoothie shops and beauty supply stores. In addition, I will offer customer loyalty rewards such as Lash-Passes, so customers can receive special bonuses for being repeat customers. Moreover, I will offer ways to incentivize business on slower days such as special discounts on “Winning Wednesday’s” or “Facial Friday’s.” My pricing strategy will hover around industry standards in order to stay competitive, but my emphasis will be on providing better quality than my competitors. I have a very comprehensive vision for Lashing Out! and in 1-3 years’ time, I look to have a steady stream of loyal clients and a thriving business. To get there, I need to provide consistent quality service, attract and retain loyal employees that take pride in their work, market as much as possible and be sound with my financial practices. If I do these things, I have no doubt that I will continue to differentiate myself from the competition and Lashing Out! will strive. Background Information Please describe your business or the business you intend to start: Lashing Out Eyelash Boutique will offer eyelash extensions and nail services where the focus is on quality and health related beauty practices. I also want to offer small retail items (eyelash tools, lipsticks and retail polish). Who will buy your product or services, and how will you attract these customers? I intend to market to women and men, starting as early as high school age. I will try to locate the business in an area that demographically represents my target market. I will use marketing techniques such as Groupons, Promotions and other incentives to solidify repeat business. Why do people want this product or service? What benefits do they get from it? People would want this service to preserve and promote their inherent beauty and to feel pampered. In certain cases, it may be therapeutic. Also, they get start this process without lifting a finger; just sit back and get pampered. Who are your competitors and what will you do that makes you different from or better than the competition? Other competitors include other local nail salons. My services will challenge the way people are currently being pampered by creating niche services. The emphasis will be on quality and not quantity. I will also reward repeat customers by offering a customer loyalty program and offering promotions on various days. 539 of 549 Please describe why you decided to go into business: I wanted the autonomy of trying new things and implementing new ideas. Also, I wanted the flexibility in running a business. Moreover, it is important to show my child another option and road to success. Do you have any work and/or educational experience directly related to your business idea? Please describe your experience or qualifications that will help you to succeed: I have a Master’s Degree in Business and over 15 years administrative and HR experience; this will help me choose the right people to complete my team and create and execute our vision for success. Please describe your current goals for the business or business idea. What are you already doing to move forward with starting or growing your business? I have created a business plan; I have met with microlenders; I have benchmarked other business to come up with a service list and price structure; I have also begun looking for potential locations. 540 of 549 Budget See attached Excel Spreadsheet 541 of 549 EXPENSE - 2016 LASHING OUT! ...beauty in the blink of an eye Tax Id# - 472-969-760 Item Ordered From Quantity Price Shipping Total LOAN AMOUNT LEND Tax Id# - 472-969-760 (10,000.00)$ Rent Leasing Agent 4 1,200.00$ 4,800.00$ Desk -Garage sale 1 50.00$ 50.00$ Eyelashes eyelashesunlimited.com 200 2.52$ 504.00$ Towel warmer x 2 Ebay 2 50.00$ 100.00$ Labeler Ebay 1 30.00$ 30.00$ Nail polishes (Gel too)Ebay 150 5.00$ 750.00$ Gel Polish Light Ebay 4 20.00$ 80.00$ Dust Collecter Ebay 2 100.00$ 200.00$ Nail dryer Ebay 4 30.00$ 120.00$ Heavy Duty UV light Ebay 1 100.00$ 100.00$ Acrylic Bowl (soak of nail)Ebay 4 20.00$ 80.00$ Beauty Industry Drill (micro engrave)Ebay 1 100.00$ 100.00$ pedicure flip flops Ebay 100 1.00$ 100.00$ Parafin Wax Ebay 5 14.00$ 70.00$ Foot Spas (Portable)Ebay 8 50.00$ 400.00$ Manicure tables Ebay 4 150.00$ 600.00$ Manicure Chairs Ebay 8 50.00$ 400.00$ Spa Tablets Ebay 100 1.00$ 100.00$ Toe separaters Ebay 100 0.15$ 15.00$ Acrylic Powder Ebay 4 10.00$ 40.00$ Acrylic Nails to decorate for display (500)Ebay 1 5.20$ 5.20$ Acrylic Nails - Tips \ (500)Ebay 4 5.99$ 23.96$ Alcohol Ebay 4 2.00$ 8.00$ Polish Remover Ebay 4 2.00$ 8.00$ Laundry Bill 4 20.00$ 80.00$ Towels Ebay 75 1.00$ 75.00$ Aluminum Foil - tips Ebay 1 30.00$ 30.00$ Lights Ebay 8 15.00$ 120.00$ Coat Rack Ebay 2 25.00$ 50.00$ Bling / Metallic Ebay 1 150.00$ 150.00$ Dry Erase Board Ikea Walmart 1 60.00$ 60.00$ Spa Chairs Ebay 4 250.00$ 1,000.00$ Display cabinet Ikea 1 300.00$ 300.00$ Storage Cabinet Ikea 1 100.00$ 100.00$ Glue - Clear eyelashesunlimited.com 6 3.95$ 23.70$ alarm ADT 9 39.99$ 359.91$ Groupon Groupon.com 1 -$ -$ Business Inspection - License City of Evanston 1 150.00$ 150.00$ Sterlization Machine eBay 2 100.00$ 200.00$ Curtains / Hardware Roses 60.00$ 60.00$ Flyers Vista Print. Com 150.00$ 150.00$ Aprons eBay 3 9.88$ 19.76$ 542 of 549 EXPENSE - 2016 LASHING OUT! ...beauty in the blink of an eye Tax Id# - 472-969-760 Item Ordered From Quantity Price Shipping Total Material Stand ebay 6 36.85$ 221.10$ Window Logo Signs Now 1 150.00$ 150.00$ Rugs Santuck 6 20.00$ 120.00$ Heat/Electric (initial)Com ED 1 150.00$ 150.00$ Cable Knology 9 100.00$ 900.00$ Pictures Maxway 2 60.00$ 120.00$ Bathroom Accessories Maxway 1 40.00$ 40.00$ Tools - files, drills buffers, applicators, cotton, bottles , skin remover tools etc eBay 100 10.00$ 1,000.00$ Glue -Black eyelashesunlimited.com 20 3.95$ 79.00$ Business Cards Vista Print. Com 1 100.00$ 100.00$ Register / Credit Card ?1 80.00$ 80.00$ labor - cleaning 9 Months 9 30.00$ 270.00$ Carpet Clean Cedrick Johnson 1 60.00$ 60.00$ Garbage - Trash/water City of Evanston 9 -$ -$ Phone AT&T 9 40.00$ 360.00$ insurance AIA 500.00$ 500.00$ Curtains Maxway 1 150.00$ 150.00$ LASH CLASS + trasnportation to Atlanta Bonner Brothers 1 500.00$ 500.00$ blow dryer Target 3 25.00$ 75.00$ Router Walmart 1 80.00$ 80.00$ Massage Table eBay 3 109.99$ 329.97$ Stools eBay 3 27.99$ 83.97$ Small Bladeless Fan eBay 2 6.58$ 13.16$ Sterlization Machine eBay 1 25.75$ 25.75$ Tools eBay 2 11.11$ 22.22$ Pink Light eBay 3 7.99$ 23.97$ Printer Walmart 1 60.00$ 60.00$ Fire Extinguisher Home Depot 1 45.00$ 45.00$ Desk - Chair Garage sale 1 20.00$ 20.00$ Folding Chair ?8 15.00$ 120.00$ Gloves Walmart 1 20.00$ 20.00$ Clock Roses 1 25.00$ 25.00$ TOTAL 14,492.63$ TOTAL 410.00$ 14,902.63$ TOTAL 860.00$ 15,762.63$ TOTAL $ 1,594.04 14,168.59$ Grand Total 14,168.59$ 543 of 549 Recliner/Pedicure Chair – Walmart - $219+ tax (Free shipping) https://www.walmart.com/ip/Serta-Big-Tall-Memory-Foam-Massage-Recliner-Multiple- Colors/46933986?wmlspartner=wlpa&adid=22222222227035674701&wl0=&wl1=g&wl2=c&wl3=96706 016208&wl4=pla- 134478149088&wl5=9021564&wl6=&wl7=&wl8=&wl9=pla&wl10=8175035&wl11=online&wl12=46933 986&wl13=&veh=sem Pedicure Soak Bowl – Alibaba - $45+tax and shipping https://www.alibaba.com/product-detail/2017-most-popular-soak-bowl- of_60654269620.html?spm=a2700.7724857.main07.151.328bced7RXpi2K 544 of 549 Manicure Chairs – Houzz - $65.99+ tax (Free Shipping) https://www.houzz.com/product/78485752-soros-ribbed-task-chair-black-contemporary-office-chairs Manicure Tables – Facebook Market place (several to choose from, depends on availability at the time) https://www.facebook.com/marketplace/105597026140500/search?query=manicure%20tables 545 of 549 Pedicure Stools – Facebook Market Place (several to choose from, depends on availability at the time) https://www.facebook.com/marketplace/105597026140500/search?query=pedicure%20stools Reception Desk - $200 Facebook Market Place (depends on availability at the time) https://www.facebook.com/marketplace/item/1732075416832031 546 of 549 Nail Technology – Certification Course - $1,000 http://www.trenzbeautyacademy.com/requirements-tuitions/ 547 of 549 Eyelash Extension Certification Course - PS LASH EXTENSION TRAINING COURSE PRICE $999 USD https://www.psextensionacademy.com/eyelash-extension-classes-chicago TO REGISTER FOR A LASH EXTENSION TRAINING COURSE PLEASE VIEW OUR COURSE SCHEDULE HERE ON-GOING SUPPORT Students who require more assistance after training are welcome to sit in on an additional training class free of charge for one calendar year after course completion. After course completion students are encouraged to join our online forum to connect with other hair extension students and our trainers to help get feedback and support in their new career. PRIVATE & ONLINE LESSONS We also offer private and online hair extension training courses on a one to one basis for both new and returning students. To view details on private lessons please click here. 548 of 549 Store Location Rental Information – $1,800/month including utilities + $1,800 deposit - 1235 Dodge St. Evanston, IL ( Dempster and Dodge -inside the Spex Carwash Location) – Contact Asad – 847.864.9274 549 of 549